KEGG   Proteus mirabilis BB2000: BB2000_2358Help
Entry
BB2000_2358       CDS       T02789                                 

Definition
(GenBank) metal-dependent phosphoesterase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
pmib  Proteus mirabilis BB2000
Brite
KEGG Orthology (KO) [BR:pmib00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BB2000_2358
Enzymes [BR:pmib01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     BB2000_2358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP SLATT_6
Motif
Other DBs
NCBI-ProteinID: AGS60822
Position
complement(2552794..2553618)
Genome map
AA seq 274 aa AA seqDB search
MIYADLHVHTNHSDGICEIKDVLENAFRNGIKTIAITDHDTTNHYDEIYREGERLGLNIV
KGVEMSCYDFDVYKKVHVVGLWLNEKTPNVDKLCDNTLNCRDQFHRELILSLNQQGYDIC
YEDAKKFSKYNIVFKMNIFQALREKYPEEMTKERYKQLFGSKTKIETDLKMGYIPVDEGI
AAILQDGGIPILAHPCVYDNYDEIEKYVQFGLKGLEISHSRMKPIDYELTQNYANKFGLL
KSGGSDFHDPALLKFGDFGLNQTQFETLKKDANK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgatctatgctgatttacatgttcacacaaaccatagtgatggtatttgtgaaataaaa
gatgttcttgaaaatgcatttagaaacggcattaagactattgcgatcaccgatcacgat
actaccaatcattacgacgaaatttaccgagaaggggagcgtcttggattaaatatcgtc
aaaggtgttgaaatgagttgttatgactttgacgtttataaaaaagtccatgtagtggga
ctttggcttaacgaaaaaacgcccaacgttgacaagctgtgtgataacactctcaactgt
cgtgatcagtttcaccgagaattaatattatctctcaatcaacaaggctacgatatttgt
tatgaagatgcgaaaaagttttcaaaatataatatcgtttttaaaatgaatatattccaa
gcattgagggaaaaatatccagaggaaatgaccaaagagcgttataaacaactttttggc
tctaaaacaaaaatagaaacagacttaaagatggggtatatccctgttgatgaaggaatt
gctgctatcttacaagatggtggtattcctatacttgctcacccatgtgtctatgacaac
tatgatgaaatagaaaagtatgtccagtttggattgaaaggattagaaataagtcattct
agaatgaaacctatcgactatgaactgacccaaaactatgctaataaatttggtttgcta
aaaagtggcggtagtgacttccatgatccagcgttacttaaatttggcgattttggccta
aatcaaacacaatttgagaccttaaaaaaggacgcaaataaataa

DBGET integrated database retrieval system