KEGG   Proteus mirabilis BB2000: BB2000_2474Help
Entry
BB2000_2474       CDS       T02789                                 

Gene name
apaG
Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
pmib  Proteus mirabilis BB2000
Brite
KEGG Orthology (KO) [BR:pmib00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BB2000_2474 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AGS60930
Position
2684141..2684518
Genome map
AA seq 125 aa AA seqDB search
MFTSSKVAIQVQSVYIESQSSPEEQRYVFAYTITIHNLNKHAIRLLRRYWLITNAQGNTT
EVQGEGVVGEQPLIEAGSRYRYTSGAVLETPMGTMEGHYEMIDAQGRLFQIDIPVFRLAI
PTLIN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgtttacttcatccaaagtggcgatacaggtacaaagcgtttacattgagagccaatct
tcgccagaagaacagcgctatgtttttgcttataccatcaccatacataacttgaataaa
catgctattcgcctcctacgtcgctattggttgatcaccaatgcacaaggaaataccact
gaagttcaaggtgaaggggttgttggtgaacaacctctgattgaagctggctcacggtat
cgttataccagtggcgcagttcttgaaacgccgatgggcaccatggaaggtcattatgaa
atgattgacgcacaaggacgtctgtttcaaattgacatccctgttttccgccttgctatc
cctacattgataaattaa

DBGET integrated database retrieval system