KEGG   Parvimonas micra: NW74_02650Help
Entry
NW74_02650        CDS       T03515                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pmic  Parvimonas micra
Pathway
pmic00450  Selenocompound metabolism
pmic00970  Aminoacyl-tRNA biosynthesis
pmic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmic00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NW74_02650
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NW74_02650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmic01007]
    NW74_02650
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmic03016]
    NW74_02650
Enzymes [BR:pmic01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     NW74_02650
Amino acid related enzymes [BR:pmic01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   NW74_02650
Transfer RNA biogenesis [BR:pmic03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NW74_02650
 Prokaryotic type
   Other AARSs
    NW74_02650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AIZ36311
UniProt: A0A0B4S0Z2
Position
580693..582642
Genome map
AA seq 649 aa AA seqDB search
MEKKNFYLTTPIYYPNSNLHLGHTYTTIVADVLKKYKQAQGFDVFFTTGTDEHGQKLQES
AIKAGKAPLEYIDPIVESAKELWKTLDIDFDAFVRSTDKIHEKNVSEIFTKLYEKGEIYK
GSYKGMYCVPCEAFWTESQLVEGNKCPDCGREVSLSEEETYFFRLSKYQDRLLKLYEENP
DFIQPESRKNEMISFINEGLTDLSVTRSSFDWGVKVPFDEKHVVYVWIDALSCYLTGIGY
GTDEEKFNKFWPCDVHLIGKEIMRFHAIIWPAILMALDLPLPKKIFGHGWILFDDDKMSK
SKGNIVYAEPIIERYGMDALRYFMLREFTFGQDGNFTYTKMLNRINSDLVNDLGNLVSRS
VAMCEKYFGGIVPAQTELTELDNDLIETAITTRDRVAELMDKLNFSMALEEIWKLVRRTN
KYIDETTPWTLIKEQKEERLKTVIYNLLESIRIISGLIKPFMKETSLRINEQIGYSDYSY
EDLTKFGLLKVGTKVCKGKNLFDRLDVDKELEIIIQKNSELIELRKKKNLGASQVKEEAK
ESELITIDDFAKVELKVGKILECQPHPKADRLLVFKIDIGDEVRTIVSGIRKYYSETDLI
GKKVIVVTNLKPVNLRGVESNGMILAASDDENLSVLTVLNDVKEGSEVS
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagaaaaacttttatttgacaacaccgatttattatccaaatagtaatttgcat
ttggggcatacttatacaacaattgttgcagatgtgttaaagaaatataaacaggctcaa
ggttttgatgtattttttacaactggtactgatgaacatggtcaaaaattacaagaatct
gctataaaagcaggtaaagctccattggaatatattgatccaatagttgaaagtgctaaa
gaactatggaaaactttagatattgattttgatgcttttgttagaagtacagataaaatt
cacgaaaaaaatgttagtgaaatttttacaaaactttatgaaaaaggagaaatttataaa
ggaagttataagggaatgtattgtgttccttgtgaagctttttggactgaaagccaactt
gttgaaggaaataaatgtcctgattgtggtagagaagtttctttaagtgaagaggaaaca
tatttctttagactttctaaatatcaagatagacttttaaaattatatgaagaaaatcct
gatttcattcaaccagaatcaagaaaaaatgagatgataagtttcattaatgaaggttta
actgatttatccgttacacgttcaagttttgattggggtgttaaagttccctttgatgaa
aagcatgttgtttacgtttggatagatgccttaagttgttatttaacaggtattggttat
ggaacagatgaagaaaaattcaataagttttggccttgtgatgttcatttaattggcaag
gagattatgcgtttccatgcaattatttggcctgcaattttaatggcactagatttacca
ttaccaaagaaaatttttggacatggttggattttatttgacgatgataagatgagtaaa
agtaaagggaatattgtttatgctgaaccgattatagaaagatatggaatggacgcatta
agatattttatgctaagagaatttacttttggacaagatggtaattttacttatacaaaa
atgttaaatagaattaattcagaccttgtaaatgatttaggtaatttagtttcaagatct
gtagcaatgtgtgaaaaatattttggtggtattgttccggctcaaacagaattaacagaa
cttgataatgatttaatcgaaactgctataactacaagagatagagttgcagagttgatg
gataaacttaatttttcaatggctcttgaagaaatatggaaattagtaagaagaacaaat
aaatatattgatgaaacaactccttggactttgattaaagaacaaaaagaagaaagatta
aaaactgtaatttataatttacttgaaagtataagaattatttcaggattaattaagcct
tttatgaaagaaacttcattaagaataaatgaacaaataggttattctgattattcttat
gaagatttaactaaatttggactacttaaagttggaacgaaagtttgtaaaggtaaaaat
ttatttgacagacttgatgttgataaagaattagaaatcataattcaaaagaattcagaa
ttaattgaattgagaaaaaagaaaaatttaggagcttctcaagttaaagaagaagctaaa
gaaagtgaacttataacaattgatgactttgcaaaagttgaacttaaggttggaaaaatc
ttagaatgtcaacctcatccaaaggcagacagacttttagtttttaaaattgatatagga
gatgaagttagaactatagtttcaggaataagaaaatactattctgaaacagatcttata
gggaaaaaagttattgttgttacaaatttaaaacctgttaatttaagaggtgttgaaagt
aatggtatgatacttgctgcatctgatgatgaaaatttaagtgtattaactgttttaaat
gatgttaaagaaggctcagaggtatcataa

DBGET integrated database retrieval system