KEGG   Prochlorococcus marinus MIT 9211: P9211_01811Help
Entry
P9211_01811       CDS       T00616                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
pmj00260  Glycine, serine and threonine metabolism
pmj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmj01100  Metabolic pathways
pmj01110  Biosynthesis of secondary metabolites
pmj01130  Biosynthesis of antibiotics
pmj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9211_01811 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P9211_01811 (trpB)
Enzymes [BR:pmj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P9211_01811 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABX08112
CyanoBase: P9211_01811
UniProt: A9BD24
Position
complement(174061..175311)
Genome map
AA seq 416 aa AA seqDB search
MTSTLPSQPKDMELANSSRPSVHGRFGRFGGQYVPETLMPALAELEKKAAEAWQDSSFTN
ELSHLLKTYVGRATPLYEAKRLSQHYMSREGGPRIWLKREDLNHTGAHKINNALGQALLA
IRMGKKRIIAETGAGQHGVATATVCARFGLECVIYMGQEDMERQALNVFRMKLLGAKVQS
VTAGTATLKDATSEAIRDWVTNVESTHYILGSVAGPHPYPMLVRDFHSVIGEETKQQCKE
AFGRSPDVLLACVGGGSNAMGLFHSFIEDLSVKMIGVEAAGDGVNTKRHAATITQGSVGV
LHGAMSLLLQDSDGQVQEAHSISAGLDYPGVGPEHSYLNEIGRAEYVAVTDKEALNALEL
VSKLEGIIPALETAHAFAWLDTLCPSLAPGTEIVINCSGRGDKDVNTVAKKMGFEI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgacaagcacgctaccctcgcaaccaaaggatatggaactcgcaaacagttcccgacca
tcggtccatggacgatttggtcgatttggaggtcaatatgtgcctgaaactcttatgcca
gctcttgctgaactagagaaaaaagctgccgaagcatggcaagattcttcattcacaaat
gaactatctcatttattaaaaacctacgtcggtcgagcaacccctttatatgaagcaaag
agattaagccagcactacatgagcagagaaggagggccaagaatttggctaaagcgagaa
gatctcaatcacaccggggctcacaaaatcaataatgctctaggacaagctcttctagca
ataagaatgggcaaaaaaagaatcattgcagagacaggtgctggccagcatggagttgca
acagcaacggtatgtgcacgatttggactggaatgcgtcatatatatgggtcaagaagat
atggaaagacaagctctaaatgtatttagaatgaaactactaggagcaaaagttcaatcg
gtcacagctggtacagccactttaaaagatgcaacaagtgaggcaattcgcgattgggtt
actaatgtcgaatcaactcattacatccttggatcagtagcaggcccacatccttatcca
atgttggttagagattttcattcagtcattggagaagagactaaacaacaatgcaaagag
gcttttggccgatcacctgatgtactactggcatgcgtcggaggaggttcaaatgcgatg
ggattattccattcattcatagaagatctttcagtaaaaatgattggtgttgaagctgct
ggagatggggtaaataccaaacgccatgctgcaacaatcacccaagggagtgtaggagta
cttcatggggctatgagccttcttcttcaagacagtgatggacaagttcaagaagcccat
tcaattagtgctgggcttgattacccaggcgtaggacctgaacatagctatctgaatgaa
ataggtcgggcagaatatgtagctgttacagataaagaagctttaaatgcccttgaacta
gtcagcaaattagaaggaattattcctgccttagaaacagcccatgcttttgcatggcta
gacacactttgcccttctcttgccccaggtactgaaatagttattaattgctctggtcga
ggagataaagatgtcaatactgttgcaaaaaaaatgggctttgaaatttaa

DBGET integrated database retrieval system