KEGG   Prochlorococcus marinus MIT 9211: P9211_04061Help
Entry
P9211_04061       CDS       T00616                                 

Definition
(GenBank) possible Cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
pmj00270  Cysteine and methionine metabolism
pmj00450  Selenocompound metabolism
pmj00920  Sulfur metabolism
pmj01100  Metabolic pathways
pmj01110  Biosynthesis of secondary metabolites
pmj01130  Biosynthesis of antibiotics
pmj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmj00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    P9211_04061
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    P9211_04061
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    P9211_04061
Enzymes [BR:pmj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     P9211_04061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ABX08337
CyanoBase: P9211_04061
UniProt: A9BE27
Position
complement(382274..383746)
Genome map
AA seq 490 aa AA seqDB search
MIARNLLIDPYWEAKDLGKAIPKSPHAVSVALPRWEDVIAYEEKDPLCMKTLQSIYPRFG
LNPLVAAISQKALMLYGKDKSSCWPYPNFLTAEKAKEYCGRINKNSKSIIQELSGLHCLV
VDNQTTPSAKAFWQHTGLGASSRQASIALNQVKPPSRNSGDNARKSIKNRLAKIYGCEPE
LIQLHPSGMAALTTALEALARLYPNKPTLQLGFPYVDVLKLPQEIFAGSELILEQEEIRI
AKELDQRKPSAVIVELPSNPMLECVDLPLIAKMAHARGIPVIADDTIGSSVNIDPLPYAD
LIFSSLTKSFAGRGDILAGSLVISPESPWKNLFKELIPNCLLATLSDADAIELEEASQDV
NVRVHQLNKSCITLKQHLEDHPDISKVLHPANCTNFKSLMRPQSGFGCLLSFELKEGLSK
AQRFYDSLQVCKGPSLGTNFTLVCPYVLLAHYEELDWAAKCGLPSSLLRVSVGLEDPDDL
WDRFKRALNS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgattgcaagaaatctgctgatagatccctattgggaagccaaagatcttggcaaggca
atacctaaaagtccacatgctgtttcagtcgcattaccccgttgggaagatgtcattgca
tatgaagaaaaagatcctttgtgcatgaaaacacttcaatcgatatatccaagatttggc
ctcaacccattagttgctgcaatctcgcagaaagctttaatgctttatggtaaagataaa
agtagctgttggccttatccaaactttttaactgcagaaaaagccaaagaatactgtgga
cgtataaacaaaaactcaaaatcaatcattcaggaattgtctggactccactgtttagtt
gtggataatcaaacgacaccatcagcaaaagcattttggcagcacacaggtcttggagct
tcttcaagacaagcctcgatagcacttaatcaagtaaaaccaccttcaagaaattcagga
gacaatgccagaaagtctataaagaatagattggcaaaaatatatggttgcgagccagaa
ttaattcaactacatccatcagggatggctgcactaacaacggcccttgaagctttagca
agactctatcctaacaagcctaccttgcaactagggttcccctatgttgatgtattaaaa
ctacctcaagaaatctttgctggaagtgagctgatcctcgagcaagaagaaatccgcata
gcaaaagaacttgatcagaggaagccctccgccgtaatagttgaactgccaagcaaccca
atgcttgaatgcgtggatttacctttaatagccaagatggcccatgctagagggatacca
gttattgcagatgacactattggttcatcggtcaatattgaccctctaccttatgcagac
ttaatctttagctcattaactaaaagttttgctgggaggggtgacattcttgcaggatct
ctagtaatcagtcctgaatctccttggaaaaatctttttaaagagttaattccgaattgc
ctcctggccaccttatctgacgcagatgcaatagagctcgaagaagctagtcaggatgtc
aatgtgcgagttcatcaattaaataaatcatgcattaccttaaagcaacatctagaagat
caccctgatatttctaaagtgctgcatccagctaattgcacaaatttcaaatctctaatg
cgacctcaatcaggttttggatgtctcctttcttttgaattaaaagagggtttatcaaaa
gcccaaagattctatgattcccttcaagtatgcaaaggtcctagcttaggtactaacttt
acattggtatgtccatatgttcttttggctcattatgaagaattagactgggctgcaaaa
tgtggactcccatctagtcttcttagagtttcagttggtctcgaagatcctgatgatcta
tgggaccgctttaaaagagctttgaattcctaa

DBGET integrated database retrieval system