KEGG   Prochlorococcus marinus MIT 9211: P9211_10301Help
Entry
P9211_10301       CDS       T00616                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
pmj00010  Glycolysis / Gluconeogenesis
pmj00620  Pyruvate metabolism
pmj00640  Propanoate metabolism
pmj00680  Methane metabolism
pmj01100  Metabolic pathways
pmj01110  Biosynthesis of secondary metabolites
pmj01120  Microbial metabolism in diverse environments
pmj01130  Biosynthesis of antibiotics
pmj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9211_10301 (acs)
   00620 Pyruvate metabolism
    P9211_10301 (acs)
   00640 Propanoate metabolism
    P9211_10301 (acs)
  Energy metabolism
   00680 Methane metabolism
    P9211_10301 (acs)
Enzymes [BR:pmj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     P9211_10301 (acs)
Lipid biosynthesis proteins [BR:pmj01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   P9211_10301 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABX08961
CyanoBase: P9211_10301
UniProt: A9BAU9
Position
complement(921683..923659)
Genome map
AA seq 658 aa AA seqDB search
MSSDPSESIESVLNEERVFDPSPDVADEARISSLSQYKMMVDQAREDPEKFWGEAARKEL
HWFEPFNQVLDWSNPPFAKWFSGGKTNISFNCLDRQIQNGNGDKEAIIWEGEPGEIRRFT
YKQLHQEVCRAANALKDLGLGKGDLVALYMPMVPEAAIAMLACARIGAPHSVVFGGFSSE
ALRDRLIDGEAKAVITADGGYRKDKVIELKSAVDLALANNACPSVKSVLVVQRTNESIDM
QTGRDHWWHDLVPSQSDFCSAEHMDSEDRLFVLYTSGSTGKPKGVVHTTAGYNLWAHLTF
QWIFDIRDDDIYWCTADVGWITGHSYIVYGPLSNGATSVMYEGVPRPSNPGAFWEVIEKH
KVSIFYTAPTAIRAFMKNGRSLPDKYNMNSLRLLGTVGEPINPEAWMWYREVIGGNRCPV
IDTWWQTETGGVMISPLPGATPTKPGSATFPLPGIEADVVNANGETVPTGEGGYLVIRKP
WPGMMRTVHGNEKRFRESYWEYLRPTGGNLIYFAGDGARRDSDGYFWVMGRVDDVINVSG
HRLGTMEIESALVSHPAVSEAAVVGRPDDLKGESVVAFVTLEGTSSASDHLINDLRNHVG
NEIGAIAKPDEIRFSDALPKTRSGKIMRRILRSLAAGNDISGDTSTLEDRSVLDKLRN
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgatccgtccgaatcaattgagtcggtccttaatgaagagagagtatttgac
ccatcacctgacgttgcagatgaggcaagaataagcagtttgtctcagtacaagatgatg
gtagatcaagctagagaagaccctgaaaaattttggggggaagctgctcgtaaggagttg
cattggttcgaaccatttaatcaagtccttgattggtctaatccaccttttgcaaaatgg
ttttctggtggcaaaacaaatatttcttttaattgcttagatcgtcagattcagaatggt
aatggagataaagaagcgattatttgggagggagagcctggagaaataagacgctttact
tataaacaactacatcaagaggtttgtcgagccgcaaatgcattaaaagatcttggttta
gggaaaggagacttggttgctctttatatgccaatggttcctgaagcggctatcgctatg
ttggcttgtgctcgtattggagcacctcactcagttgtttttggtggattttcttctgaa
gcattacgtgatcgcttgattgatggtgaagctaaagctgtcattacagcagatggggga
tacagaaaagacaaggttatcgagcttaaatctgctgttgatttggccttagctaataac
gcatgcccaagtgttaaatctgttttagtcgttcaacgtacgaatgaatcaatagacatg
caaacgggaagagatcattggtggcatgatcttgtaccttcccaaagcgatttttgctct
gcggaacatatggatagtgaagataggctttttgttttatatacatcaggatcaacggga
aaacctaaaggagttgttcataccacagctggctataacttatgggctcaccttactttt
caatggatctttgatatacgagatgatgatatttattggtgtacagcagacgttggttgg
ataacaggccatagctatatcgtttatggaccactttccaatggggctacaagtgttatg
tatgagggtgttccacgtccttcaaatcctggagcattttgggaagtaatagaaaaacat
aaggtttcgatcttttatacagctccaactgctattagagcatttatgaagaatgggcgt
tctcttcctgataagtacaatatgaatagtttgaggttgttaggaactgtaggcgaacct
attaaccctgaagcttggatgtggtatcgcgaagttattggaggtaaccgttgcccggtt
atagatacttggtggcaaacggaaactggaggtgtaatgataagtcctttgcctggagcc
acccctacaaagccaggctcagcaacttttccattacctggtatcgaagcagatgttgtt
aatgcaaatggtgagactgttccaaccggagagggaggatatttagtaataagaaagcct
tggcctggaatgatgagaacagttcacggaaatgaaaaacgatttagagaaagttattgg
gaatatttaagacctaccggcggcaatctcatctactttgcaggcgatggagcgagaagg
gattcggatggatatttttgggtaatgggaagagttgatgatgtaataaatgtttctggg
cataggcttggaactatggaaatagaatctgctttggttagtcacccagctgtttctgaa
gctgctgttgttggaaggccggatgatcttaagggggagtccgttgtggcttttgttact
cttgagggtacttcttctgcaagtgaccatctcattaatgacttgcggaatcatgtaggc
aatgaaattggagctatagctaaacctgatgaaattcgttttagtgacgccttaccaaag
actagaagcggtaaaattatgagacgaatacttagatctttagcagcaggcaatgacatt
agtggtgatactagtactcttgaagaccgaagtgttctagataaattaaggaactaa

DBGET integrated database retrieval system