KEGG   Pseudomonas mendocina NK-01: MDS_0021
Entry
MDS_0021          CDS       T01473                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    MDS_0021
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmk02044]
    MDS_0021
Secretion system [BR:pmk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MDS_0021
SSDB
Motif
Pfam: VipB VipB_2 BMFP RRF
Other DBs
NCBI-ProteinID: AEB56052
Position
27087..28580
AA seq 497 aa
MSEQLQQDQAALASTEQTSEFASLLMQEFKPKTERAKEAVETAVRTLAEQALAQTDLISN
DAIKSIESIIAAIDAKLTAQVNQIIHHSDFQQVESAWRGLHYLVNNTESDEQLKIRVLNI
SKPELHKTLKKFKGTAWDQSPVFKKLYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGE
LSKVCAAMHAPFISAASPTVMGMGSWQELSNPRDLTKIFTTPEYAGWRSLRESEDSRYIG
LTMPRFLARLPYGAKTDPVEAFAFEENTDGADSSKYTWANAAYAMAVNINRSFKHYGWCS
RIRGVESGGEVPNLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMPLLHKKNTDF
AAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKERDEM
QLWLQDWILKYVDGDPAHSTETTKAQHPLAAAEVVVEEVEGNPGYYNSKFYLRPHYQLEG
LTVSLRLVSKLPSAKGA
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgagcgaacagttgcaacaagaccaggccgcactggccagcaccgagcagaccagcgaa
tttgcctcgctgctgatgcaggaattcaaacccaagaccgaacgtgccaaggaagcggtg
gagactgccgtgcgtaccctggccgagcaggcgctggcgcaaaccgatctgatctccaac
gatgcgatcaagtcgatcgagtcgatcatcgccgccatcgacgccaagctcaccgcgcag
gtcaaccagatcatccaccacagcgactttcagcaggtggaaagcgcctggcgtggtctg
cactacctggtgaacaacaccgagagcgacgagcagctgaagattcgcgtgctcaacatc
tccaagccggagctgcacaagaccctgaagaaattcaagggcaccgcctgggaccagagc
ccggtgttcaagaaactctacgaagaggaatacggccagttcggtggcgagccctacggc
tgcctggtcggcgattactacttcgatcagtcgccgcccgatgtcgagttgctcggtgag
ctgtccaaggtctgcgcggcgatgcacgcgccgttcatttccgcggcctcgccgacagtg
atgggcatgggctcctggcaggaactgtccaacccgcgcgacctgaccaagatcttcacc
accccggaatacgctggctggcgctcgctacgcgagtccgaggattcgcgttacatcggc
ctgaccatgccgcgtttcctggcccgcctgccatatggcgccaagaccgatccggtagaa
gccttcgccttcgaggaaaacaccgacggcgccgacagcagcaagtacacctgggccaac
gctgcctatgccatggcggtgaacatcaaccgttcgttcaagcactacggctggtgctcg
cgcattcgtggcgtcgagtccggtggcgaggtaccgaacctgccggcgcacaccttcccc
accgatgatggtggcgtggacatgaagtgccccaccgagatcgccatttccgaccgtcgc
gaggccgagctggcgaagaatggcttcatgccgctgctgcacaagaagaacaccgacttc
gccgccttcatcggtgcgcagtcgctgcagaaaccggccgagtacgacgatccggacgcc
accgccaacgccaacctggccgcgcgcctgccgtacctgttcgccacctgccgcttcgcg
cattacctcaagtgcatcgttcgcgacaagatcggctcgttcaaggagcgcgacgagatg
cagctgtggctgcaggactggatcctcaagtacgtcgacggtgaccccgctcactccacc
gagaccaccaaggcgcagcacccactcgctgctgcagaagtcgtggtggaagaggtggag
ggcaacccgggttactacaactcgaagttctacctgcgtccgcactatcagctcgaaggg
ctgacggtgtcgctgcggctggtttccaaactgccgtcggccaagggcgcataa

DBGET integrated database retrieval system