KEGG   Pseudomonas mendocina NK-01: MDS_0022
Entry
MDS_0022          CDS       T01473                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk02025  Biofilm formation - Pseudomonas aeruginosa
pmk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    MDS_0022
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    MDS_0022
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmk02044]
    MDS_0022
Secretion system [BR:pmk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MDS_0022
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AEB56053
Position
28721..29209
AA seq 162 aa
MAVDIFIKIGDIKGESQDKTHKDEIEVLNWSWGMSQSGNMHTGTGGGAGKVSIQDLSLTK
YVDKATPNLMMHCSSGKHVPKVTLTVRKAGGDSQVEYLIINLEEVLISSLSTGGSGNDDR
LIENVTLNFAKVTVDYQPQKADGTKEGGPIKYGWNIRSNVKI
NT seq 489 nt   +upstreamnt  +downstreamnt
atggctgttgatatcttcatcaagatcggtgacatcaagggcgagtcccaggacaagacc
cacaaggacgaaatcgaagtgctcaactggagctggggcatgtcccagtccggcaatatg
cacaccggcaccggtggcggcgcgggcaaggtgagcatccaggacctgtcgctgaccaag
tacgtcgacaaggctacccccaacctgatgatgcattgctccagcggcaagcacgtgccc
aaggtcaccctgaccgtgcgcaaggcaggcggtgattcccaggtcgagtacctgatcatc
aacctcgaagaagtgctgatctcctcgctgagcactggcggttcgggcaacgacgaccgc
ctgatcgagaacgtgaccctgaacttcgccaaagtcacggtcgactaccagccgcagaaa
gccgacggcaccaaggaaggcggcccgatcaagtacggctggaacatccgttccaacgtc
aagatctga

DBGET integrated database retrieval system