KEGG   Pseudomonas mendocina NK-01: MDS_0027Help
Entry
MDS_0027          CDS       T01473                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    MDS_0027
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmk02044]
    MDS_0027
Secretion system [BR:pmk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MDS_0027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: AEB56058
Position
32538..33590
Genome map
AA seq 350 aa AA seqDB search
MESPARPSSEPLDTLAQMQAQPWEYDFFQALRRIENEHPHLPRLGRSRRLADDPLRLGQR
QEGTFAPATLAAVTPAGDQRPARLEQYFFGLGGPNGPLPLHLTEYVRERQRNHADSTSKH
FLDLFHHRLLSLFYRAWAEARPTVSHDRPDDDYWSARLAAFSGRGMPSLRRPGLLDDAAK
LHYSGHLAAQTRYPDGLKAILADYFGVPVQIEEYAGSWLSLPERTRLGVESSQLGVDFCL
GSQVWDRQHSFRICFGPLTLDQYNAMLPDGESFAALVAWVAEYQGDELDWQLNLVLQREE
VPALRLNGQARLGYTTWLGQPQHDARDLVLARHHAAATSPADQSRRTPHG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcccggcccggccgtcgtccgaacctctagacacgcttgcgcagatgcaggcg
cagccctgggagtacgacttcttccaggccctgcgacgcatcgagaacgagcacccgcac
ctgccgcgcctgggccgttcccggcgcctggcagacgatccgctgcgcctcggccagcgc
caggaaggcacgttcgctccagccacgctggccgctgtaacgcccgccggcgaccagcgt
ccggcacgcctggagcagtatttcttcggcctcggcgggcccaacggaccgctgccgctg
cacctgaccgagtacgtgcgcgagcgtcagcgcaaccacgccgacagcaccagcaagcac
ttcctcgacctgtttcatcatcgcctgctgagcctgttctatcgtgcctgggccgaagcg
cggccgaccgtcagccatgaccgcccggatgacgactactggtcggcgcgcctggccgcc
ttcagtggtcgcggcatgcccagcctgcgccggccgggcctgctggatgatgcggcgaag
cttcactacagcggtcacctggccgcgcagacgcgttaccccgatggcctcaaggcgatc
cttgccgactacttcggggtgccggtgcagatcgaggaatacgccggcagctggctcagc
ctgcccgagcgcacgcgcctgggcgtggagtccagccaacttggcgtggacttctgcctg
ggcagccaggtctgggatcgccagcacagcttccgtatctgcttcggcccgctgacgctc
gatcagtacaacgccatgctgcccgatggcgagtcgttcgccgcgctggtggcctgggtc
gccgaataccagggcgacgagctggactggcaactgaatctcgtattgcagcgcgaggaa
gtccccgcgctgcgtctcaacggccaggctcgcctgggctacaccacctggcttggtcag
ccacagcacgacgccagggatctggtgctggcccgccatcacgccgcagcaacttcgccg
gcggatcaatcaaggagaactccacatgggtga

DBGET integrated database retrieval system