KEGG   Pseudomonas mendocina NK-01: MDS_0029
Entry
MDS_0029          CDS       T01473                                 

Definition
(GenBank) rhs-family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    MDS_0029
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmk02044]
    MDS_0029
Secretion system [BR:pmk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MDS_0029
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C Sarcoglycan_1
Other DBs
NCBI-ProteinID: AEB56060
Position
36314..38254
AA seq 646 aa
MFFAQSSRFARITSPLGPDVLLLRSMHGSDELGRLFEYELQLVSHDANLDLNQLLGKPLT
LSVQQHGGGDRHFHGIVAACGQSVDRGQFAAYRVTLRPWLWLLSRTSDCRIFQHMSVPQI
IKQVFRDLGFSDFEDALSRPYREWEYCVQYRETSFDFVSRLMEKEGIYYYFRHEADRHVL
VLADAYGAHVPAPGYASVPYFPPDGQHRERDHINDWQLAQHVQPGSMELNDYDFQRPSAR
IDVRSVMPRPHNAGDYPLYDYPGAYVQSSDGEQYARNRIEALQSLHERVELGGSVRGIAS
GNLFSLTGFGRADQNREYLVVCARYHVLQESLETGSGGGGQFECQLTCTDAQQTFRPLCG
TPKPMVQGPQTAVVVGPAGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQNWAGKN
WGAIQIPRIGQEVIVSFLEGDPDQPIITGRVYNAEQTVPYDLPANATQSGIKSRSSKGGT
PANFNEIRMEDKKGAEQLYIHAERNQDIVVEVDETHSVGNNRTKSIGMNETVTIGNNRLR
AVKLDDVLLVGSTKTDSISQSYLIEVGQNLRLVCGKSILELNASGQINLSGVAINFHASG
DAEFNTGGVLNLNIGGGPGATPDGQGDQGSIDAAVKSLFGQEKGNA
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgttcttcgcccaatcttcccgctttgcccgcatcaccagcccgctcgggccggacgtt
ctgctgctgcgctcgatgcacggcagcgacgagctgggccgtctgttcgaatacgagctg
caactggtgtcccacgatgccaacctcgatctcaaccagttgctcggcaagccgctgacg
ctctcagtgcagcagcatggcggtggcgaccggcatttccacggcatcgtcgccgcctgc
gggcagagcgtcgaccgcggccagttcgcggcttatcgggttaccctgcggccctggctt
tggctgctcagccgcacctccgactgccgcatcttccagcacatgagcgtgccgcagatc
atcaagcaggtgttccgcgacctggggttctccgatttcgaagacgcgctgagccgcccg
taccgcgagtgggagtactgcgtgcagtaccgcgaaaccagcttcgacttcgtcagccgg
ctgatggagaaggagggcatctactactacttccgccacgaggccgatcgccacgtgctg
gtactggccgatgcctacggcgcgcatgtgccggcacccggttacgccagcgtgccctac
ttcccgccggacgggcagcaccgcgagcgtgaccacatcaacgactggcaactggcccag
cacgtgcagccgggctcgatggaactcaacgactacgacttccagcgccccagcgcgcgc
atcgacgtgcgctcggtcatgccgcgtccgcacaatgccggcgactatccgctgtacgac
tacccgggtgcctacgtgcagagcagcgacggcgagcagtacgcgcgcaatcgcatcgag
gcgctgcagagtctgcacgagcgcgtcgagctcggcggcagcgtgcgcggcatcgcctcg
ggcaacctgttcagcctcaccggcttcggtcgcgccgaccaaaaccgcgagtacctggtg
gtctgcgcgcgctatcacgtcctgcaggagtccctggagactggcagtggcggcggtggc
cagtttgagtgccaactcacctgcaccgacgctcagcagaccttccgcccgctgtgcggc
acgcccaagccgatggtgcaggggccgcagaccgccgtggtggtcggccccgccggcgag
gagatctggaccgatcagtacggccgggtcaaggtgcacttccactgggatcgccacgac
cagtccaacgagaacagctcctgctggattcgcgtctcgcagaactgggccggcaagaac
tggggtgcgatccagattccacgcatcggccaggaggtcatcgtcagcttcctggagggt
gatcccgaccagccgatcatcaccggccgcgtctacaacgccgaacagaccgtgccctac
gacctgcccgccaacgccacccagagcggcatcaagagccgctccagcaagggcggcacg
ccggccaacttcaacgaaatccgcatggaggacaagaagggcgccgagcagctgtacatc
catgccgaacgcaaccaggacatcgtcgtcgaggtggatgaaacccactcggtgggcaac
aaccgcaccaagagcatcggcatgaacgagacggtgaccatcggcaacaaccgcctgcgc
gcggtgaagctcgatgacgtgctgctggtgggctcgaccaagaccgacagcatcagccag
agctacctcatcgaggtcggccagaacctgcgcctggtctgcggcaagagcattctcgaa
ctcaacgccagcggtcagatcaacctcagcggcgtggcgatcaacttccacgccagcggc
gacgcggaattcaacacaggcggcgtgctcaacctgaacatcggcggcggccctggcgcc
acccccgatggccagggtgaccagggcagcattgatgcggccgtcaaatccctgttcggg
caagagaaaggaaacgcctga

DBGET integrated database retrieval system