KEGG   Pseudomonas mendocina NK-01: MDS_0411Help
Entry
MDS_0411          CDS       T01473                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pmk  Pseudomonas mendocina NK-01
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MDS_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF2371
Motif
Other DBs
NCBI-ProteinID: AEB56442
Position
430685..431956
Genome map
AA seq 423 aa AA seqDB search
MSLIADYGLVLLVLACLFGFFMAWGVGANDVANAMGTSVGSRALTIKQAIIIAMVFEFAG
AYLAGGEVTETIKNGIVDANLISPNLMVLGMMSALLAAGTWLLVASMRGWPVSTTHTIVG
AVIGFAAVGVSVDAVHWSGVGPIVASWVVTPMLAGIISFCLFVSVQKLIIDTDNPFMNAK
RYVPLYMFITGFMISLMTMTKGLKHVGLNLSSTEGFMLSLGVGVLVMLIGIALLSRIHVD
AEADKAFHFSSVEKVFAILMIFTACSMAFAHGSNDVANAVGPLAAIVGVIQSGGDLAAGD
KSLVPGWILLLGALGIVVGLATYGYKVIATIGKEITELTPSRGFAAELAAATTVVSASGL
GLPVSTTHTLVGAILGVGLARGIGALNLGMIGKIFLSWIITLPAGAILSIIFFFILRSLF
GGV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgattgcggactacgggctggttctgctcgttcttgcctgccttttcggtttt
ttcatggcctggggtgttggagccaacgatgtagccaatgctatgggtacatccgttggc
tcgcgtgcacttaccatcaagcaggcgatcatcatcgccatggtcttcgagttcgccggt
gcctacctggccggcggcgaggtgaccgaaaccatcaagaacggcatcgtcgatgccaat
ctgatcagccccaacctcatggtgttgggcatgatgtcggcgctgttggcggcaggcacc
tggctgctggtggcgtcgatgcgcggctggccggtgtccaccacccacaccatcgtcggt
gcggtgatcggtttcgccgcagtcggtgtatcggttgatgccgtgcactggagcggcgtc
ggccccatcgtcgccagctgggtcgtcacgccgatgctcgccgggatcatctccttctgc
ctgttcgtcagcgtgcagaagctgatcatcgataccgacaatccgttcatgaacgccaag
cgctatgtgccgctgtacatgttcatcaccggcttcatgatttcgctgatgaccatgacc
aaggggctcaagcacgtcggcctgaacctctccagcaccgaaggcttcatgctctcgctg
ggcgtcggggtgctggtcatgctgatcggtatcgccttgctcagccgcatccatgtcgat
gctgaagctgacaaggctttccacttctccagcgtggagaaggtgttcgccatcctgatg
atcttcaccgcctgctccatggccttcgctcatggctccaacgacgtggccaatgccgtt
ggcccgctggcggccatcgtcggtgtgatccagagtggcggtgacctggccgctggcgac
aagtcgctggtaccgggctggatcctgctgctgggcgcgctgggcatcgtggtcggcctg
gcgacctacggctacaaggtaatcgccaccatcggcaaggaaatcaccgagctgaccccc
agccgcggcttcgccgccgaactggctgccgccaccaccgtggtcagtgcctcgggtctc
ggcctgccggtatccactacccacaccctggttggtgccattctgggcgtcggcctggcg
cgcggcatcggtgcgctgaacctgggcatgatcggcaagatcttcctgtcctggatcatc
accctgccagctggtgcgatcctgtcgatcatcttcttcttcatcctgcgctcgctgttc
ggcggggtttga

DBGET integrated database retrieval system