KEGG   Pseudomonas mendocina NK-01: MDS_0418Help
Entry
MDS_0418          CDS       T01473                                 

Definition
(GenBank) osmolarity response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MDS_0418
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pmk02022]
    MDS_0418
Two-component system [BR:pmk02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   MDS_0418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ DUF43 TusA
Motif
Other DBs
NCBI-ProteinID: AEB56449
Position
439621..440358
Genome map
AA seq 245 aa AA seqDB search
MTQSAAPATEGEKILIVDDDARLRRLLERFFDEQGYRVRAVENVEQMDRLLARELFNLVV
LDLMLPGEDGLSACRRLRESNNQIPIIMLTAKGDESSRIQGLELGADDYLAKPFNPRELL
ARIKAVLRRQAPVVPGAPGAEDESVSFGDYELSLATRELKKGEEVHMLTTGEFAVLKALV
QHAREPLTRDKLMNLARGREWDALERSIDVQISRLRRLIEPDPSKPRYIQTVWGVGYVFV
PDGNK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtccgctgcccctgccaccgaaggcgagaagattctcatcgtcgatgacgac
gcccgtctgcgccgcctgctcgaacgcttcttcgacgagcagggctatcgggtacgtgca
gtggagaacgtcgagcagatggatcgcctgctggcgcgcgagctgttcaacctagtggtg
ctcgacctgatgctgcccggtgaggatggattgtccgcctgccgccgcctgcgcgaatcg
aacaaccagatcccgatcatcatgctcaccgccaagggcgatgagtccagccgtatccag
ggcctggagctgggcgccgatgattacctggccaagcctttcaacccacgcgaattgctg
gcccgcatcaaggctgtgttgcgccgtcaggcgccggtggtgcctggtgcgccgggtgcc
gaggatgaaagcgtcagcttcggtgactatgaactgtcgctggccacgcgtgaactgaag
aagggtgaggaagtgcacatgctcaccactggcgagttcgccgtgctcaaggccctggtg
cagcatgcgcgcgagccgctgacccgcgacaagctgatgaacctggcccgtggccgcgag
tgggatgcactggagcgctccatcgacgtgcagatcagtcgcctgcgtcgcctgatcgag
ccggacccgtcgaaaccgcgctatatccagaccgtctggggcgttggctacgtgttcgtg
ccggacggcaacaagtga

DBGET integrated database retrieval system