KEGG   Pseudomonas mendocina NK-01: MDS_0456Help
Entry
MDS_0456          CDS       T01473                                 

Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00240  Pyrimidine metabolism
pmk00250  Alanine, aspartate and glutamate metabolism
pmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MDS_0456
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MDS_0456
Enzymes [BR:pmk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MDS_0456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AEB56487
UniProt: F4DZQ9
Position
complement(484078..485085)
Genome map
AA seq 335 aa AA seqDB search
MTPLAAKRPLQLNDQGQLRHFLSLDGLPRELLTEILDTADSFLEVGARAVKKVPLLRGKT
VCNVFFENSTRTRTTFELAAQRLSADVISLNVSTSSTSKGETLFDTLRNLEAMAADIFVV
RHADSGAAHFIAEHVCPNLAIINGGDGRHAHPTQGMLDMLTIRRHKGDFENLSVAIVGDI
LHSRVARSNMLALKTLGCPDIRVIAPKTLLPIGLEESYGVRVFSDANEGLKDVDVVIMLR
LQRERMQGGLLPSEGEFYRLFGLTEQRLKLAKPDALVMHPGPINRGVEIESAVADGPQSV
ILNQVTYGIAIRMAVLSMAMSGQNAQRQLNAEEAN
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacgccactcgccgccaagcgcccgctgcagctgaacgaccaaggtcagctgcgccac
ttcctctcactcgacggcctgccccgtgagctgttgaccgaaatcctcgacaccgccgac
tccttcctcgaagtcggggcgcgggcggtgaagaaagtcccgctgctgcgcggcaagacc
gtgtgcaacgtgttcttcgagaactccacgcgcacccgcaccaccttcgagctggccgcc
cagcgcctgtcggccgacgttatcagcctcaacgtgtcgaccagttccaccagcaagggc
gagacgctgttcgacactctgcgcaacctcgaagccatggccgccgatatcttcgtggtg
cgccatgccgactccggcgccgcgcacttcatcgccgagcacgtgtgcccgaacctggca
atcatcaacggtggcgacggccgccacgcgcacccgacccagggcatgctcgacatgctc
accatccgccgccacaagggcgacttcgagaacctctcggtggccatcgtcggcgatatc
ctacattcgcgggtggcacgttcgaacatgctggcgctgaagaccctgggctgcccggat
atccgggtgattgcgccgaagaccctgctgcccatcggcctggaagaaagttacggcgtg
cgcgtgttcagcgacgccaacgaaggcctcaaggacgtcgacgtggtgatcatgctacgc
ctgcagcgcgagcgcatgcagggcggcctgctgcccagcgagggcgagttctaccgcctg
ttcggcctcaccgagcagcgcctgaaactggccaagccggatgccctggtgatgcacccg
ggcccgatcaaccgcggcgtggagatcgagtcggcggtggccgacggcccgcaatcggtg
atcctcaaccaggtcacctacggcatcgccatccgcatggccgtgctgtcgatggccatg
agcgggcagaacgcccaacgtcaactcaacgccgaggaggccaactga

DBGET integrated database retrieval system