KEGG   Pseudomonas mendocina NK-01: MDS_0648Help
Entry
MDS_0648          CDS       T01473                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00010  Glycolysis / Gluconeogenesis
pmk00020  Citrate cycle (TCA cycle)
pmk00620  Pyruvate metabolism
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01120  Microbial metabolism in diverse environments
pmk01130  Biosynthesis of antibiotics
pmk01200  Carbon metabolism
Module
pmk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MDS_0648
   00020 Citrate cycle (TCA cycle)
    MDS_0648
   00620 Pyruvate metabolism
    MDS_0648
Enzymes [BR:pmk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MDS_0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEB56679
UniProt: F4DNB9
Position
complement(696910..698553)
Genome map
AA seq 547 aa AA seqDB search
MSELIRVPDLGGEGEVIELLVKVGDRIEADQSVLTLESDKASMEVPSPKAGVVKELKVKI
GDRLKEGDELLVLEVEGAAQAAPAPKAEAAPAEAPKAAAPAAAPAAAATGSSVQDVHVPD
IGSSAKGKVIEIMVKAGDSIEADQSLLTLESDKASMEIPSPAAGVVEQVLVKLDDEIGTG
DLILKLKVAGSASAPAPAQASQEVHRVPEGAAPEVAAEVRAIASLSAAAAEVANAPKRDG
AKVHAGPAVRQLARDFGVELADIAGTGPKGRILKEDVQAYVKAMMQKAKAAPQATAAAAT
SGAGIPPIPAVDFSKFGEIEEVAMTRLMQVGAANLHRSWLNVPHVTQFDSADITDLEAFR
VAQKAVAEKAGVKLTVLPLLLKSCAHLLKELPDFNSSLAPSGKAIIRKKYVHIGFAVDTP
DGLLVPVIKNVDQKSLLQLAAEAAELADKARKKKLSADDMQGACFTISSLGHIGGTGFTP
IVNAPEVAILGVSKATMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTQRLSQLLA
DIRTILL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagttgattcgcgtacccgacctcggcggtgaaggcgaggtcattgaactgctg
gtcaaggtcggcgaccgcatcgaagccgatcagagcgtactgaccctggagtccgacaag
gcctccatggaagtcccctcgcccaaggccggcgtagtcaaggaactgaaggtcaagatc
ggcgatcgcctgaaagaaggcgacgagttgctggtgctggaagtcgaaggtgctgcgcaa
gcagcgcctgcgccgaaggccgaagccgcacctgccgaagcccctaaagcggccgctccg
gcagccgcgcccgccgctgcagccactggcagcagcgtgcaggacgtgcacgtgccggac
atcggctccagcgccaagggcaaggtcatcgagatcatggtcaaggccggcgacagcatc
gaagccgaccagagcctgctgaccctggagtccgacaaggcctccatggaaatcccctcg
ccggctgccggcgtggtggaacaggtgctggtcaagctggatgacgaaatcggtactggc
gacctgatcctcaagctcaaggtcgccggctccgcttctgcacccgccccggcgcaagcc
agccaggaagtgcaccgcgtgccggaaggtgcggcgccggaagtggccgccgaagtgcgc
gccatcgcctcgctgtcggcagctgccgccgaagtcgccaatgcgcccaagcgcgatggc
gccaaggtgcatgccggcccggccgtgcgtcagctggcccgcgacttcggcgtggagctg
gcggatatcgccggcaccggcccgaaaggtcgcatcctcaaggaagacgtgcaggcttac
gtcaaggcgatgatgcagaaggccaaggccgcaccgcaggcgactgctgcagccgctacc
agcggcgccggcattccgccgatcccggcggtggacttcagcaagttcggtgaaatcgaa
gaggtggcgatgacccgcctgatgcaggtcggcgctgccaacctgcatcgcagctggctc
aacgtgccgcacgtgacccagttcgactcggccgacatcaccgacctggaagccttccgc
gtcgcgcagaaggccgtggccgaaaaggctggcgtcaagctgaccgtactgccgctgctg
ctcaaatcctgcgcgcacctgctcaaggaactgccggacttcaacagttcgctggcgccg
agcggcaaggcgatcatccgcaagaaatacgtgcatatcggcttcgccgtcgatacgccg
gacggcctgctggtgccggtgatcaagaacgtcgatcagaagagcctgctgcaactggca
gccgaagcggccgaactggccgacaaggcgcgcaagaagaagctgtcggctgacgacatg
cagggtgcctgcttcaccatctccagcctcggccacattggcggcaccggcttcacgccg
atcgtcaacgcgccggaagtggcgatcctcggtgtgagcaaggccaccatgcagccggtc
tgggacggcaaggccttccagccgcgcctgatgctgccgctgtcgctgtcctacgatcac
cgcgtgatcaatggtgccgccgctgcccgcttcacccagcgcctgtcgcagctgctggcc
gacatccgcaccatcctgctgtaa

DBGET integrated database retrieval system