KEGG   Pseudomonas mendocina NK-01: MDS_0973Help
Entry
MDS_0973          CDS       T01473                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00340  Histidine metabolism
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    MDS_0973
Enzymes [BR:pmk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MDS_0973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEB57004
UniProt: F4DRY3
Position
1072471..1073778
Genome map
AA seq 435 aa AA seqDB search
MTAPVAIRRLNAADTDFARHLDHLLSWESVSDDGVNQRVLEIIQAVRERGDAALVEYTQR
FDGLEVASMADLILPRERLELALTRISPEQRQALEVAAERVRSYHEKQMQDSWRYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVPEVVMVVPTPRGEINEIVLA
AAAIAGVDRVFTIGGAQAVAALAYGTESVPPVDKIVGPGNIYVATAKRHVFGKVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQSILVSPDAAFLDRVAESIAKLLPTMER
AEIIRTSLEGRGALIQVADMAQAIIVANRIAPEHLELSVADPEAWLPEIRHAGAIFMGRY
TAEALGDYVAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSPDGASELGKSASVLARS
ESLTAHARSAEYRIK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacccgttgccatccgccgactcaacgccgccgatacggacttcgcgcgtcat
ctggatcatctgctgtcctgggaaagtgtctccgacgatggcgtcaaccagcgcgtgctg
gaaatcatccaggccgtgcgcgagcgtggtgacgctgcgctggtcgagtacacccagcgt
ttcgatggcctcgaagtcgcttccatggccgacctgatcctgccgcgcgagcgtctggaa
ctggcgctgacccgcatcagccccgagcagcgccaggcgctggaagtggccgctgagcgc
gtgcgcagctatcacgaaaagcagatgcaggattcctggcgctacaccgaagccgacggc
accgtgctgggccagaaggtcaccccgctggaccgcgcaggcctgtatgtgccgggtggc
aaggcttcctacccgtcctcggtgctgatgaacgcgattcccgccaaggtcgccggtgtg
cccgaagtggtgatggtggtgccgaccccgcgcggcgagatcaacgagatcgtccttgct
gccgccgccatcgctggcgttgaccgcgtcttcaccatcggcggtgcccaggccgtcgcc
gcgctggcctatggcaccgagagcgtgccgccggtggataagatcgtcggccccggcaac
atctatgtggccactgccaagcgccacgtgttcggcaaggtgggcatcgacatgatcgcc
gggccttccgagattttggtggtgtgcgatggccagactgacccggattggatcgccatg
gatctgttctcccaggccgagcacgacgaagacgctcagtcgattctggtcagcccggat
gccgccttcctcgaccgcgtggccgagagcatcgccaagctgctgccgaccatggagcgt
gcagagatcatccgcacctcgctggaaggccgtggtgcgctgatccaggtagccgacatg
gcccaggccatcatcgttgccaaccgcatcgcgccggagcacctggagctttcggtggct
gacccagaggcctggttacccgagattcgccacgctggcgcgatcttcatgggccgctac
acagcagaggccttgggcgactatgtggctggcccgaaccacgtactgccgacgtcgggc
accgcgcggttctcctcgccgctgggtgtctacgactttcagaaacgctcgtcgatcatc
ttctgctcgccggatggcgcgtcggagctgggcaagagtgcttccgtgctggcccgtagc
gagtcgctgaccgcgcatgcgcgcagcgccgagtatcggatcaagtaa

DBGET integrated database retrieval system