KEGG   Pseudomonas mendocina NK-01: MDS_1190Help
Entry
MDS_1190          CDS       T01473                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00071  Fatty acid degradation
pmk00072  Synthesis and degradation of ketone bodies
pmk00280  Valine, leucine and isoleucine degradation
pmk00310  Lysine degradation
pmk00362  Benzoate degradation
pmk00380  Tryptophan metabolism
pmk00620  Pyruvate metabolism
pmk00630  Glyoxylate and dicarboxylate metabolism
pmk00640  Propanoate metabolism
pmk00650  Butanoate metabolism
pmk00900  Terpenoid backbone biosynthesis
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01120  Microbial metabolism in diverse environments
pmk01130  Biosynthesis of antibiotics
pmk01200  Carbon metabolism
pmk01212  Fatty acid metabolism
pmk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MDS_1190
   00630 Glyoxylate and dicarboxylate metabolism
    MDS_1190
   00640 Propanoate metabolism
    MDS_1190
   00650 Butanoate metabolism
    MDS_1190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MDS_1190
   00072 Synthesis and degradation of ketone bodies
    MDS_1190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MDS_1190
   00310 Lysine degradation
    MDS_1190
   00380 Tryptophan metabolism
    MDS_1190
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MDS_1190
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MDS_1190
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MDS_1190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmk04147]
    MDS_1190
Enzymes [BR:pmk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MDS_1190
Exosome [BR:pmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MDS_1190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEB57221
UniProt: F4DTX4
Position
complement(1297916..1299097)
Genome map
AA seq 393 aa AA seqDB search
MQDVVIVAATRTAIGSFQGSLADIPAPELGAIVIKRLLEQTGLDAAQVDEVILGQVLTAG
SGQNPARQAAIRAGLPHAVPAMTLNKVCGSGLKALHLATQAIRCGDAEVIIAGGMENMSL
APYVLPKARTGLRMGHAQMLDSMIVDGLWDAFNDYHMGITAENLVDKYGVSREAQDAFAA
ASQQKAVAAIEAGRFDAEITPVLIPQRKGDPVAFARDEQPRAGTTAESLAKLKPAFKKDG
SVTAGNASSLNDGAAAVLLMSAAKAQALGLPVLAKIAGYANAGVDPAIMGIAPVSATRRC
LDKAGWSLADLDLIEANEAFAAQALSVGQELGWDADKVNVNGGAIALGHPIGASGCRVLV
SLLHEMIRRDAKKGLATLCIGGGQGVALAIERA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgtcatcgttgccgctacccgcaccgccatcggcagcttccagggcagc
ctggccgatattcccgcgccggaactcggcgccatcgtcatcaagcgcctgctggagcag
actggcctcgacgctgcccaggtcgatgaagtcatcctcggtcaggtactcaccgcaggc
agtggccagaaccccgcacgccaggccgccatccgcgccggcctgccgcatgccgtgccc
gccatgaccctgaacaaggtctgtggctcgggcctcaaggccctgcacctggccacccag
gccattcgctgcggcgacgccgaggtgatcatcgccggcggcatggagaacatgagcctg
gcgccctacgtgctgcccaaagcccgcaccggtctgcgcatgggtcacgcacagatgctc
gacagcatgatcgtcgacggcctgtgggatgccttcaacgactaccacatgggcatcacc
gccgagaacctggtggacaagtacggcgtcagccgtgaagcccaggacgccttcgccgcc
gcttcgcagcaaaaggccgtggcggccatcgaagccgggcgctttgacgctgaaatcacc
ccggtgctgatcccgcagcgcaagggcgacccagtcgccttcgcccgtgacgagcagcca
cgcgccggcaccaccgccgaatccctggccaagctcaaacccgcattcaagaaggacggc
agcgtcaccgccggcaacgcctccagcctcaacgacggtgccgctgccgtgctgctgatg
agcgcggccaaagcgcaggcgctgggtctgccggtactggcgaagatcgctggctatgcc
aatgccggtgtcgatccggcgatcatgggcatcgccccggtatcggctacccgccgttgc
ctggacaaggccggctggagcctggccgacctggacctgatcgaagccaacgaagctttc
gcggcccaggcgctgtcggtcggccaggagctgggttgggatgccgacaaggtcaacgtc
aatggcggcgccatcgccctcggccaccccatcggcgcctcgggctgccgtgtgctggtc
agcctgctgcacgagatgatccgtcgcgacgccaagaaaggccttgccacgctgtgcatc
ggtggcggccagggcgtagcgctggccatcgaacgcgcctga

DBGET integrated database retrieval system