KEGG   Pseudomonas mendocina NK-01: MDS_1754Help
Entry
MDS_1754          CDS       T01473                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00260  Glycine, serine and threonine metabolism
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01120  Microbial metabolism in diverse environments
pmk01130  Biosynthesis of antibiotics
pmk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MDS_1754
Enzymes [BR:pmk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     MDS_1754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Arylesterase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AEB57785
Position
1899863..1900867
Genome map
AA seq 334 aa AA seqDB search
MPLIDLRSDTVTQPTAAMREAMMAAELGDDVYGEDPTVNRLEAWLAAELGFEAALFVPTG
TMSNLLALMAHCERGDEYIVGQQAHTYKYEGGGAAVLGSIQPQPIEGEVDGSLDLAKVEA
TIKQDDFHFARTRLLALENTMQGKVLPLDYLAAAREFTLRRGLSLHLDGARLYNASVKLQ
LPAREITQYFDSVSVCLSKGLGAPVGSVLCGHAELIAKARRLRKMVGGGMRQAGVLAAAG
LYALQHQVQRLAEDHAKAAHLGEALTELGYSVEPVQTNMVYVQLGERAGQIKGFMAERGI
AVSAAPRLRLVTHLDVGSAGVERVIEAFAAFRSH
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgatcgacctgcgtagtgacaccgtcacccaacccactgccgccatgcgcgaa
gccatgatggctgccgagctgggtgacgatgtgtatggcgaggaccctacggtcaatcgc
ctggaggcctggttggcggcggagctaggcttcgaggctgcgttgttcgtgcccaccggc
accatgagcaacctgctagccctgatggcgcattgcgaacgcggtgacgaatacatcgtc
ggccagcaggcgcatacctataaatacgagggcggtggagccgctgtgcttggttccatc
cagccgcagccgatcgaaggcgaggtcgatggctcgctggacctggccaaggtcgaagcg
acgatcaaacaggacgacttccacttcgctcgcacccgtctgctggcactggaaaacacc
atgcagggcaaggtgctgccgctcgattatctggcggctgcgcgggaatttaccctgcgt
cggggtctgagcctgcatctggatggcgcacgtttgtacaacgcatcggtcaagctgcag
ttgccggcacgcgagattacccagtatttcgattcggtgtcggtgtgcctgtccaagggg
ctcggcgcgcccgtcggctcggtgctctgtggtcacgcggaattgattgccaaggcgcgg
cgcctgcgcaagatggttggcggtggcatgcgtcaggccggcgtgctggcggcagcaggc
ttgtatgcgctgcagcatcaggttcagcgcctggccgaagatcacgccaaggccgcacac
ttgggcgaggcgttaaccgagctgggttatagcgtcgagccggtgcagaccaatatggtc
tacgtacagctcggcgagcgtgccgggcagatcaagggctttatggccgaacgaggcatt
gccgtcagtgccgcgccgcgtctgcgcctggtgactcatctggatgttggaagcgcgggc
gtcgagcgcgtgatcgaggcgttcgctgcctttcgttcccattga

DBGET integrated database retrieval system