KEGG   Pseudomonas mendocina NK-01: MDS_2907Help
Entry
MDS_2907          CDS       T01473                                 

Definition
(GenBank) conjugal transfer protein TrbL
  KO
K07344  type IV secretion system protein TrbL
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MDS_2907
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmk02044]
    MDS_2907
Secretion system [BR:pmk02044]
 Type IV secretion system
  Trb secretion system protein
   MDS_2907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbL
Motif
Other DBs
NCBI-ProteinID: AEB58938
Position
3210883..3212043
Genome map
AA seq 386 aa AA seqDB search
MNDVSVIDRFLEVFGLYIDTGFGLLGGEVAFLTMTLVVIDMTLAGLFWAMGGEDVSAKLI
RKTLYVGAFAFIIGNFNSLAKIVFNSFAGLGLLASGSGLSHAEFLQPGRLATIGVDTGGP
LLEQISKLSGFPEVFSNLHSILVLFLAWLVVIVSFFFLAIQLFVTLVEFKLTTLAGFVLV
PFALWNKTAFLAEKVLGNVVASGIKVLVLAVIVGIGSGLFAEFQAVPEEPSIDHALVVML
ASLALLGLGIFGPGIATGLVSGAPQLGAGAAAGTALGAVGMAAGAAAVATGVGGAVLAGA
RMAPGAARLAVGGARSLAGAPSGATASGAPATSDPATAPAKQPDWARRLQRRQQLSQATS
TVAHTLRGGDGGGSSPGPQIRDPSNS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgtcagcgtgatcgaccgattcctcgaggtgttcgggctgtatatcgacacc
ggcttcggcctgctcggcggtgaggtggcctttctcaccatgaccctggtggtgatcgac
atgaccctggccgggctgttctgggccatgggcggtgaggatgtcagcgccaagctgatc
cgcaagaccctctatgtcggtgccttcgccttcatcatcggcaacttcaattccctggcg
aagatcgtcttcaactccttcgccgggttgggtctgctggcctcaggttccgggttgagt
catgcggagtttctgcagccagggcgattggccacgattggggttgataccggagggccg
ctgcttgagcagatcagcaagctcagtggatttcccgaagttttcagcaacctgcacagc
attctggtgctgtttctggcctggctggtggtcatcgtcagtttcttcttcctggccatt
cagctgttcgtgaccttggtcgaattcaagctgaccacccttgctggcttcgtgctggtg
ccctttgcgctgtggaacaagactgcctttctcgccgagaaggtgctgggcaacgtggtc
gcgtccggcatcaaggtgctggtgctggcggtgatcgtcggcattggcagcgggctgttc
gccgagtttcaggccgtcccggaggagccctccatcgatcacgcgctggtggtcatgctc
gcctcgctggctctgctcggcctgggcattttcggcccgggcattgccaccggcctggtt
tccggcgcaccgcaactgggtgctggtgcagcagccggcactgccctcggtgcagtgggc
atggctgctggtgctgctgcagtagcaacaggtgtcggcggcgcggtattggccggcgcg
cgcatggcgcccggtgccgcgcgcttggcagtgggtggcgctcgctctctggcaggagcc
ccctccggcgctacagcaagtggtgcccccgccacttccgatcctgcaactgccccagcc
aaacagcccgactgggccaggcgcctgcagcgcaggcaacagctctcacaggccaccagt
acggtcgcccacacccttcgtggtggcgatggcggtggttcatcacctgggccgcagatc
cgcgacccatcgaattcgtaa

DBGET integrated database retrieval system