KEGG   Pseudomonas mendocina NK-01: MDS_2909
Entry
MDS_2909          CDS       T01473                                 
Name
(GenBank) P-type conjugative transfer protein TrbG
  KO
K20532  type IV secretion system protein TrbG
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MDS_2909
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmk02044]
    MDS_2909
Secretion system [BR:pmk02044]
 Type IV secretion system
  Trb secretion system protein
   MDS_2909
SSDB
Motif
Pfam: CagX
Other DBs
NCBI-ProteinID: AEB58940
Position
3212760..3213746
AA seq 328 aa
MRTTQSIYICPLLLSVLAGCASQQPPVIALDEPVEAQRLPEPPRPIEVVEISQPLALPAQ
LKPLPETQRSKPAKEPADERVRVSRANRDARVAPSREGYINAIQVWSYSDGALYQVYASP
GRVTAINLQPGEELVTVAAGDTVRWIVGDTTSGSGDELRTSVLIKPTRVDLKTNLVITTT
RRTYLIELSSTEQAWMASVSWDYPKDRMLALQRRASAAQAAAPVDAGLALEQLRFRYAIS
GSNPPWKPLRAFDDGRKVYIQFPAGIAQGELPPLFVIGPEGDGQLVNYRFRSPYYIVDRL
FGAAELRLGADKSDVVRIERTDGVARRR
NT seq 987 nt   +upstreamnt  +downstreamnt
atgagaactacccagagcatttacatctgccctctactgctgagcgtgctggccggctgt
gccagccagcagccgccagtgatcgcgctggatgagccggtagaagcgcagcgcctgcca
gagccgcccaggcccatcgaagtggtggaaatttcccagcccttggcactgccggcgcag
ctcaagccattgccggaaactcagcgcagtaagccggccaaggaaccggccgatgagcgc
gtgcgggtctcacgtgccaatcgcgacgcccgcgtggcaccgagtcgcgagggctatatc
aacgccatccaggtgtggtcctactccgatggcgcgctgtatcaggtgtacgccagccca
ggacgggtgaccgcaatcaacctgcagcccggcgaggaacttgtcaccgtagccgctggc
gacaccgtgcgctggatcgtcggcgacaccaccagcggaagcggagacgagctacgcacc
agcgtgctgatcaagccgacacgcgtcgacctcaagaccaacctggtgatcaccaccacg
cgccgtacctacctgatcgagctgagttccaccgagcaggcctggatggcgtcggtgtcc
tgggactatccgaaggatcgcatgctcgccctgcaacgccgtgccagtgccgctcaggcc
gcggcgccagtggatgccggcctggcgctggagcagttgcgcttccgctatgcaatcagc
ggcagcaatccaccctggaagccgctacgtgccttcgatgacggccgcaaggtgtatatc
cagttccccgccggtatcgcccaaggcgagctgccgccgctgttcgtaattggccccgaa
ggtgacggacagctggtcaactatcgtttccgctcaccctactacatcgtcgaccgcctg
ttcggcgcggccgagctgcgcttgggcgccgacaagagtgacgtggtgcggatcgagcgc
accgacggcgtggcacggaggcgctga

DBGET integrated database retrieval system