KEGG   Pseudomonas mendocina NK-01: MDS_3377Help
Entry
MDS_3377          CDS       T01473                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00010  Glycolysis / Gluconeogenesis
pmk00052  Galactose metabolism
pmk00500  Starch and sucrose metabolism
pmk00520  Amino sugar and nucleotide sugar metabolism
pmk00521  Streptomycin biosynthesis
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01120  Microbial metabolism in diverse environments
pmk01130  Biosynthesis of antibiotics
pmk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MDS_3377
   00052 Galactose metabolism
    MDS_3377
   00500 Starch and sucrose metabolism
    MDS_3377
   00520 Amino sugar and nucleotide sugar metabolism
    MDS_3377
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MDS_3377
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MDS_3377
Enzymes [BR:pmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MDS_3377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AEB59408
UniProt: F4DPU6
Position
complement(3735790..3736752)
Genome map
AA seq 320 aa AA seqDB search
MKLALVGDIGGTNARFALWRDDHLEAVQVLATADFPGPEQAIMAYLQAQGLPLGAIGSVC
LACAGPVSGDLFRFTNNHWRIDRTAFCQALQVDELLMINDFFAMALGMTRLAEHERIPVC
EGQAQAERPVLVIGAGTGLGVGTLLEQADGRWLVLPGEGGHVDLPIGSPREAELWQILHR
QLGHVRAEDVLSGNGLLALYRAICELDGQPRRHDTPAAITTAGLAGESVAAEVLEQFSCW
LGRVAGNNVLTLGARGGVYIVGGVVPRFAERFLTSGFAKSFSDKGCMSHYLDGVPVWLVT
AEYPGLTGAGVALQQRAEAG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactggcgctggtcggcgacatcggtggaaccaacgcacgcttcgccctgtggcgt
gacgatcatctggaggcggtacaggtgctggcgaccgccgattttcccgggccggagcag
gccatcatggcctatctgcaggcccagggcctgccgttgggggcgataggctcggtgtgc
ctggcctgcgctgggccggtcagcggtgacctgttccgttttaccaacaaccattggcgc
atcgatcgcacagccttctgccaggcgttgcaggtcgacgagctgctgatgatcaacgat
ttcttcgccatggcgttgggcatgacccgcctggccgagcacgagcggataccagtgtgc
gagggccaggcgcaggcagagcggccggtgctggtgatcggcgccggtaccggtctgggc
gtcggtacgctgctggagcaggccgacggccgctggctggtgttgccgggggagggcggg
catgtcgacctgcccattggcagcccgcgtgaagccgagctgtggcagattctccatcga
caactggggcacgtaagggccgaagacgtgctcagcggcaatggcttgctggcgctttac
cgcgccatctgcgagctggacggccagccgcggcggcacgatacgccggctgcgatcacg
actgccggcctggcgggcgagtccgtcgctgccgaggtattggagcagttcagttgctgg
ctcgggcgcgtggccggcaacaatgtgctgacgctgggcgcgcgtggcggggtctacatc
gtcggcggcgtggtaccgcgttttgccgagcgttttctcaccagcggttttgccaagagt
ttcagcgacaagggctgcatgagccattaccttgacggcgtcccggtgtggctggtgacg
gccgagtatccaggcctgaccggcgccggcgtggccttgcaacagagggcagaggccggt
tag

DBGET integrated database retrieval system