KEGG   Pseudomonas mendocina NK-01: MDS_4352Help
Entry
MDS_4352          CDS       T01473                                 

Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
pmk  Pseudomonas mendocina NK-01
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    MDS_4352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Chitin_bind_4 LuxE
Motif
Other DBs
NCBI-ProteinID: AEB60383
Position
4765462..4765842
Genome map
AA seq 126 aa AA seqDB search
MHDPRYQIDVSVTTRYLAAQSQPEQNRYAFSYTVTIVNNGELPAQLLSRHWIITDGDGRV
QEVRGAGVIGQQPHIEPGASHTYSSGTVMTTQVGTMQGSYQMLAEDGKRFEATIAPFRLA
VPGALH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaccctcgttatcagatcgacgtcagcgtcaccacccgctatctggctgcgcaa
tcgcagccggagcagaaccgctacgcgttctcctacacagtcaccatcgtcaataacggc
gagctgccggcgcaactgctgtcgcgccactggatcatcaccgatggcgacggccgcgtg
caggaagtccgcggcgccggtgtgatcggccagcaaccgcatatcgagccgggcgccagc
cacacctacagcagcggaacggtcatgaccacccaggtcggcaccatgcagggcagttac
cagatgctcgccgaagacggcaagcgcttcgaggcgaccatcgcgccgttccgcctggca
gtacccggggccttgcactga

DBGET integrated database retrieval system