KEGG   Pseudomonas mendocina NK-01: MDS_4709Help
Entry
MDS_4709          CDS       T01473                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00010  Glycolysis / Gluconeogenesis
pmk00030  Pentose phosphate pathway
pmk00051  Fructose and mannose metabolism
pmk00052  Galactose metabolism
pmk00230  Purine metabolism
pmk00500  Starch and sucrose metabolism
pmk00520  Amino sugar and nucleotide sugar metabolism
pmk00521  Streptomycin biosynthesis
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01120  Microbial metabolism in diverse environments
pmk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MDS_4709
   00030 Pentose phosphate pathway
    MDS_4709
   00051 Fructose and mannose metabolism
    MDS_4709
   00052 Galactose metabolism
    MDS_4709
   00500 Starch and sucrose metabolism
    MDS_4709
   00520 Amino sugar and nucleotide sugar metabolism
    MDS_4709
  Nucleotide metabolism
   00230 Purine metabolism
    MDS_4709
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MDS_4709
Enzymes [BR:pmk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MDS_4709
    5.4.2.8  phosphomannomutase
     MDS_4709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: AEB60740
UniProt: F4DQY4
Position
5157862..5160450
Genome map
AA seq 862 aa AA seqDB search
MKLFKRTAKEVDSAASLVPDQPKRKATNPSLGTLLPGLLAALIGVGAGGALLWFADSSSS
QARQAELTQALGSNQAAAVQQALKQLQADSLAAARNPQLLQALQSGDSLQVSEAERSLGY
WDGVIDAHLNRRGEAVQNTSRAAPMNFAGLDMLRRAESGQQPAVEAYRVGQRWLAYSAVA
LRVGENQPAQGTLLLAFDLQRLLATLPALPAEYGQVQLIQQFANTPAQVLVQRGQPGEGS
AQTFSTGNPYWKISFIPGPALMQSSVPASMLGLALLLALGGAVIGLILVQGALQRRVNLD
AGQLGQMLKELSAGKNVKAFSLSVPALDTLAQSLARLPRRSSPEGSSTPVKGTAAAPATQ
PAAKPAELVDPLFQDTDILDIDILDEDQDLLGLEQSPAMSTSQSAPKLPADIFRAYDIRG
VVGDTLTAEYAYWIGRAIGSKSLAQGEPKVIVGRDGRLSGPELLQQLVQGLLDCGCEVTD
IGMVPTPVVYFAANVLEGRSAVMLTGSHNPPDYNGFKIIIAGDTLANEQILALKTRLDNN
DLASGVGSVQQVDVLQRYFKTIRDDIALAKPLRVVVDCGNGAAGVIAPQLIEALGCSVIP
LFCEVDGTFPNHHPDPGKPENLVDLIARVKSENADLGLAFDGDGDRVGVVTNTGTIVYPD
RLLMLFAKDVVSRNPGADIIFDVKCTRRLTPLISGYGGRPVMWKTGHSLIKKKMKETGAL
LAGEMSGHIFFKERWYGFDDGIYSAARLLEILSLEKRNAEQVFSAFPSDISTPEINIKVT
EQTKFGMIERLQREGQWGEANITSIDGVRVDYPKGWGLIRASNTTPVLVLRFEADTQEEL
ERIQDVFRTQLLKVAPDLQLPF
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactcttcaagcgtactgccaaggaagtcgatagcgccgccagcctggtaccggac
cagcccaagcgcaaggcgaccaatccctcgctggggacgctgttgccaggcctgctggcc
gccctgatcggcgtcggcgccggcggtgcgttgctgtggttcgccgatagcagcagcagc
caggctcgccaggccgagttgacccaggccctcggcagcaaccaggctgccgctgtacaa
caggcgctcaagcaactgcaagccgacagcctggccgctgcgcgtaacccgcagctgctg
caagcactgcaaagcggcgacagcctgcaggtcagcgaagccgaacgcagcctgggttac
tgggacggtgtgatcgacgcccatctcaaccgccgcggtgaagccgtgcagaacaccagc
cgcgccgcgccgatgaacttcgccggcctggacatgctgcgccgcgccgaaagcggccag
cagcccgccgtcgaagcctaccgggtcggtcagcgctggctggcctacagcgccgtggcc
ctgcgcgttggcgagaaccagccggctcagggcacgctgttgctggccttcgacctgcaa
cgcctgctcgccaccctgcctgcgctgcctgccgaatacggccaggtgcagctgatccag
cagttcgccaacaccccggcgcaggtgctggtgcaacgtggccagcccggcgagggcagc
gcacaaaccttttccaccggcaatccgtactggaagatcagctttatccccggcccagcg
ctgatgcagagcagcgtacctgcgtcgatgctcggcctggctcttttgcttgccctgggc
ggcgccgtgatcggcctgatcctggtgcaaggcgccctgcaacggcgcgtcaacctcgat
gcagggcagctcggacaaatgctgaaagaactctctgccggcaagaacgtcaaagccttc
agcctcagcgtgccggcactcgatacgctggcacagagcctggcgcgcttgccgcgccgc
agcagccctgaaggcagcagtacccccgttaaaggaacagccgcggcacccgccactcag
ccggcagccaagccagccgagctggtcgacccgctgtttcaggacaccgatatcctcgat
atcgacattctcgatgaagaccaggatctcctgggactggagcagagccccgcaatgagc
actagccaaagcgccccgaaacttcccgccgacattttccgtgcctacgacattcgtggc
gtggtgggtgacaccctgaccgccgaatacgcctactggatcggccgcgccatcggctcg
aagagcctggcccagggcgagcccaaggtcatcgttggccgtgacggccgcctgtccggc
cccgaactgctgcagcaactggtacagggcctgctcgactgcggctgcgaagtcactgat
atcggcatggtgccgaccccagtggtgtacttcgctgccaacgtgctggagggccgttcg
gccgtgatgctcaccggcagccacaacccgccggattacaacggcttcaagatcatcatc
gctggcgacaccctggccaacgagcagatccttgcgctgaagacccgcctggacaacaac
gacctggccagcggcgtcggcagcgtgcagcaggtcgacgtgctgcagcgctatttcaag
accatccgtgacgacatcgccctggccaagccactgcgcgtggtggtcgactgcggcaat
ggcgccgcgggcgtgatcgccccgcaactgatcgaggcgctgggctgcagcgtgattccg
ctgttctgcgaagtggacggcaccttccccaaccaccacccggatccgggcaagccggag
aacctggtcgacctgatcgcccgcgtcaaatccgagaatgccgacctgggcctggcgttc
gacggcgacggcgaccgcgtcggcgtggtgaccaacaccggcaccatcgtctacccggac
cgcctgctgatgctgttcgccaaggacgtggtctcgcgtaaccccggcgccgacatcatc
ttcgacgtcaaatgcacccgtcgcctgaccccgctgatcagtggctacggtggccgtccg
gtgatgtggaagaccggccactctctgatcaagaagaaaatgaaggaaaccggcgccctg
ctggctggcgagatgagcggtcacatcttcttcaaggagcgctggtacggtttcgacgat
ggtatctacagcgctgcgcgcctgctggagatcctcagcctcgagaaacgcaacgccgag
caggtgttcagcgccttccccagcgacatttccacgccggaaatcaacatcaaggtcacc
gagcaaaccaagttcggcatgatcgagcggctgcagcgcgaaggccaatggggcgaggcg
aacatcaccagcatcgacggcgtgcgcgtcgactatcccaagggctggggcctgatccgc
gcctccaacaccacgccggtgctggtgctgcgcttcgaagccgacacccaggaagagctg
gagcgtatccaggacgtcttccgcacccaattgctcaaggtcgcccccgacctgcaacta
cccttttga

DBGET integrated database retrieval system