KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM0113Help
Entry
PMM0113           CDS       T00142                                 

Gene name
hemD
Definition
(GenBank) putative uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00860  Porphyrin and chlorophyll metabolism
pmm01100  Metabolic pathways
pmm01110  Biosynthesis of secondary metabolites
pmm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMM0113 (hemD)
Enzymes [BR:pmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PMM0113 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CAE18572
CYORF: PMM0113
UniProt: Q7V3G2
Position
113674..114483
Genome map
AA seq 269 aa AA seqDB search
MREIIKMSELSLNQKNIIITRSKDKISDVKKLFTNKGAQIFDFPAIDVGYPDDLNPLDDA
LSEINDFHWIIFTSSNGIQFVDERLRNLNTSLKECSKKIKIAVVGEKTSLTLSDLGIEAD
FVPPEFVAESLIENFPVSGYGLRVFLPRVQTGGRNFIADEFRNSGSRVVEVPAYETRCPD
SIPIETINAISNRKIDAMVFSSGKTVSNSSFLLEKEFGEEWLTYLENAKLLTIGPQTSKI
CGKTFGRVDKEAVKYTFEGLLDAAIDIFN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
ttgagggaaataataaaaatgtctgagctctctttgaatcaaaaaaatataattattact
cgatcaaaagataagatatctgatgtaaaaaagttattcactaataaaggagctcaaata
tttgattttccagcaattgatgttggatatcctgatgatttaaatcctcttgatgatgcc
ttaagcgaaattaacgattttcactggattatttttaccagtagtaatggaatacaattt
gtagatgagagattaagaaatttaaatacttcattaaaagaatgttcgaagaaaataaaa
attgctgtagtaggggagaaaacttccttaactctaagcgatttaggtattgaggctgat
ttcgtccccccagaatttgtagcagaaagtttaattgaaaattttccggtatcaggatat
ggactcagagtttttttgccaagagttcaaacaggaggaaggaatttcatagctgatgaa
ttcaggaattctggttcgcgtgttgtagaggttccagcctatgaaacaagatgtccggat
tcaattcctatagaaacaataaatgctatctctaacagaaaaattgatgcaatggttttt
tcaagtggtaaaacagtatcaaattcttctttcttgcttgaaaaagaatttggggaagaa
tggttaacctatctagaaaatgcaaaattattaactattggacctcaaacttcaaaaata
tgtggaaaaacttttggcagagttgataaagaggcggttaagtacacttttgaaggatta
ttagatgcggcaattgatatttttaattag

DBGET integrated database retrieval system