KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM0152Help
Entry
PMM0152           CDS       T00142                                 

Definition
(GenBank) Putative sugar-phosphate nucleotidyl transferase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00051  Fructose and mannose metabolism
pmm00520  Amino sugar and nucleotide sugar metabolism
pmm01100  Metabolic pathways
pmm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PMM0152
   00520 Amino sugar and nucleotide sugar metabolism
    PMM0152
Enzymes [BR:pmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     PMM0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep
Motif
Other DBs
NCBI-ProteinID: CAE18611
CYORF: PMM0152
UniProt: Q7V3C6
Position
149447..150625
Genome map
AA seq 392 aa AA seqDB search
MKAMILAAGKGTRVQPITHIIPKPMIPILQKPVMEFLLELLKEHGFKEIMVNVSHLAEEI
ENYFRDGQRFGVEIAYSFEGRIEDGEMIGDALGSAGGLKKIQDFQNFFDETFVVLCGDAL
VDLDLTEAVKNHKKKGAIASLITKKVTREQVSSYGVVVSDENGRIKAFQEKPDVEDALSD
SINTGIYLFEPEIFNYIPSGDKFDIGADLFPKLVEMDLPFFALPMDFEWVDIGKVPDYWS
AIRNVLLGKVRQVEIPGKEIKPGVFTGLNVAANWDKVNIKGPVYIGGMTRIEDGATIIGP
SMIGPSCCICEGATIDNSIIFDYSKIGKGVQLVDKLVFGRYCVGKNGDHFDLKDASLDWL
ITDSRRLDLTEPSPQQKAMAELLGTDLINIPD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaatgatacttgcagcaggcaaaggaactcgcgttcagccaataacgcatatt
attcctaaaccaatgattcctattttgcaaaaacccgtgatggaattcctcttggaactt
ttaaaagaacatggttttaaagaaataatggtaaatgtttctcatcttgcagaggaaata
gaaaactattttagggacggacaaagatttggtgttgagatagcctacagctttgaagga
agaattgaagatggagaaatgattggtgatgctttgggttcggccggaggattaaaaaaa
attcaagattttcaaaacttttttgatgaaacttttgttgtattgtgcggcgacgcctta
gttgatttagatttgactgaagcggttaaaaatcataagaaaaaaggtgcaatagcaagc
ctaataacaaaaaaggtaactagagaacaggtatctagttatggagttgtagtatctgat
gaaaatgggcgaattaaagcttttcaagaaaaaccagatgtagaagatgctttgagtgat
tcaattaatactggtatttatctttttgagcctgagatttttaactatattccatcagga
gataaatttgatattggtgctgatctttttcctaaacttgttgaaatggatttaccattt
tttgctttgccgatggattttgagtgggtagatattggaaaagttcctgattactggagt
gcgattagaaatgttttattaggtaaagtaaggcaagtggaaattcctggtaaagaaata
aagcctggagtctttactggtcttaatgttgctgcaaattgggataaagttaatataaaa
ggacctgtttatatcggagggatgacaagaatagaagatggtgcaactattattggcccc
tctatgattggaccaagttgttgcatttgtgagggtgcaactattgataattctataatc
tttgattattcaaaaattgggaaaggagtacaacttgtcgataaattagtatttggtaga
tattgtgttggaaagaatggagaccattttgatttgaaagatgcttctttggactggtta
ataacagactcaagaagattagatttaactgaaccatctcctcaacaaaaagcgatggca
gaattactaggaactgatttgattaacattccagattga

DBGET integrated database retrieval system