KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM0165Help
Entry
PMM0165           CDS       T00142                                 

Definition
(GenBank) Translation initiation factor SUI1
  KO
K03113  translation initiation factor 1
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Brite
KEGG Orthology (KO) [BR:pmm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pmm03012]
    PMM0165
Translation factors [BR:pmm03012]
 Eukaryotic Type
  Initiation factors
   eIF-1
    PMM0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SUI1
Motif
Other DBs
NCBI-ProteinID: CAE18624
CYORF: PMM0165
UniProt: Q7V3B7
Position
160714..161025
Genome map
AA seq 103 aa AA seqDB search
MGKKNWIEFDNQENIYKEKSKEENFQKISKINISKQKKGKKGKTITLIKGLSIGNEIEVK
ELLKKMKVFCGTGGTLIGEDIQLQGDMVIKSIEFLRKEGFQNL
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaaaaattggattgaatttgataatcaggaaaatatttataaagaaaaatct
aaagaagagaattttcaaaaaatatcaaaaataaatatctcaaaacaaaaaaaaggtaaa
aaaggaaaaactattactttgataaaaggtttatctattggaaatgaaattgaagttaag
gaattactaaaaaaaatgaaagtgttttgtggtactggaggaactttaataggtgaagat
attcaattacaaggtgatatggtaatcaaatcaattgagtttcttcgcaaagaaggattt
caaaatttatga

DBGET integrated database retrieval system