KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM0187Help
Entry
PMM0187           CDS       T00142                                 

Gene name
argS
Definition
(GenBank) Arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pmm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PMM0187 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmm01007]
    PMM0187 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmm03016]
    PMM0187 (argS)
   03029 Mitochondrial biogenesis [BR:pmm03029]
    PMM0187 (argS)
Enzymes [BR:pmm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     PMM0187 (argS)
Amino acid related enzymes [BR:pmm01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   PMM0187 (argS)
Transfer RNA biogenesis [BR:pmm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PMM0187 (argS)
 Prokaryotic type
   Other AARSs
    PMM0187 (argS)
Mitochondrial biogenesis [BR:pmm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PMM0187 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N Syd tRNA-synt_1e DUF3294
Motif
Other DBs
NCBI-ProteinID: CAE18646
CYORF: PMM0187
UniProt: Q7V396
Position
complement(178178..179989)
Genome map
AA seq 603 aa AA seqDB search
MQTIFKELTKSFEETLLESLIKNEKKEEFEKIRKNLINQASKEEFGDYQCNICLVLSKIY
KSNPREIAIAFIETLKENKKISNLCENLEIAGPGFINIKLKNKVLIEAIKSNIKCPRAGV
PLSHKNNIYSKKKVIVDFSSPNIAKEMHVGHLRSTIIGDSISKIFEFRGYIVLRLNHIGD
WGTQFGMLITQLKDLYSSDLKEIDRIKISDLVEFYKASKKRFDNETEFQKRSREEVVQLQ
SGDKKSIEAWKLLCNQSRKEFDQIYKTLNIKIKERGESFYNPFLKSIIEDLNYKKILIED
QGAKCVFLDGMTNKEGNPLPLIIQKKDGGFNYATTDLAALRYRFTKEPYGDNAARIIYVT
DHGQSNHFAGVFQVAKRANWIPKDCEVNHVPFGLVQGIDGKKLKTREGDTIKLKDLLSES
VKRAKEDLLKRLENESRFENDDFVLNTSKVIGIGAVKYADLSQNRITNYQFSFEKMLSLN
GNTAPYLLYTLVRISGINRKNNMTEEAINLESISYSHDLEWKLIRKLLKFDEVIISIEKD
LMPNRLCNYLFELCKTFNRFYDQVPILKGEIDTKISRLTLCALTEKTLKLSLELLGIETL
ERM
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaatttttaaagaattaactaaaagctttgaagaaacccttctagaaagtctt
ataaaaaatgaaaagaaagaagaatttgaaaaaatacgtaaaaatctaattaatcaagca
tctaaagaggagtttggtgattatcaatgtaatatatgtctggttttatctaagatttat
aaaagtaaccctagagaaattgctattgcatttattgagaccctcaaagaaaataaaaag
atatctaatttgtgtgaaaatttagaaattgcgggaccaggttttataaatataaaatta
aaaaataaagttttgattgaagcaataaaatctaatattaaatgccctagagcaggtgtt
cctttatcccataaaaataatatttattccaaaaaaaaagttatcgtagatttttcaagt
cctaatattgctaaagaaatgcatgtgggtcatctaagatcaacaattataggagattcg
atctcaaaaattttcgaatttagaggatatatcgttttaagactaaatcacattggagat
tggggtacacaatttggaatgcttattacacagcttaaagatttatattcaagtgatctt
aaagaaatcgatagaataaaaattagtgatttagttgaattctataaagcttcaaaaaaa
agatttgataatgaaacagaatttcaaaagagatcaagagaagaggttgttcaattacaa
agtggagataaaaaatcaattgaagcatggaaattattatgtaatcaatcaagaaaagag
tttgatcaaatctataaaacattgaacataaaaattaaggaaagaggagaatccttttat
aatccgtttttaaaatcaataattgaggatttaaattacaagaaaattttaatagaagat
caaggcgcaaaatgtgtttttcttgatggcatgactaataaagaaggtaatccattacca
cttattattcagaaaaaagacggtgggttcaattatgcaactactgatcttgctgctcta
agatatcgatttactaaggaaccttatggcgataatgcagctagaattatttatgtaaca
gatcatggacaatccaatcattttgcaggagtttttcaagttgcaaaaagagctaattgg
atccctaaagattgtgaagtaaatcacgtcccatttgggctagtacaaggaattgatggc
aaaaaacttaaaacaagagagggagataccataaaactcaaagatttattatcagagtca
gttaaaagagcaaaagaagatctattaaaaagattagagaacgaaagtcgttttgaaaat
gatgattttgttttaaatacttcaaaagttattggaatcggagcagtaaaatatgctgat
ttaagccaaaatagaatcacaaattatcaatttagttttgaaaaaatgctttctcttaat
ggaaatacggcgccttatcttttgtatacacttgtaagaatttcaggaattaatagaaaa
aataatatgactgaagaggcaataaatttggaatctatttcctatagccatgatttagag
tggaagcttataaggaaattacttaaatttgatgaagttattatttcgatagaaaaagac
ttaatgccaaatagactatgtaattatctgtttgaattatgtaagacttttaatagattt
tatgatcaagttcctattcttaagggagaaatagatacaaagatttcaagacttacatta
tgtgctttaactgaaaagactttaaaattaagtttagagcttcttggaattgaaacctta
gagagaatgtaa

DBGET integrated database retrieval system