KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM0619Help
Entry
PMM0619           CDS       T00142                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00010  Glycolysis / Gluconeogenesis
pmm00620  Pyruvate metabolism
pmm00640  Propanoate metabolism
pmm00680  Methane metabolism
pmm01100  Metabolic pathways
pmm01110  Biosynthesis of secondary metabolites
pmm01120  Microbial metabolism in diverse environments
pmm01130  Biosynthesis of antibiotics
pmm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMM0619 (acs)
   00620 Pyruvate metabolism
    PMM0619 (acs)
   00640 Propanoate metabolism
    PMM0619 (acs)
  Energy metabolism
   00680 Methane metabolism
    PMM0619 (acs)
Enzymes [BR:pmm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PMM0619 (acs)
Lipid biosynthesis proteins [BR:pmm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PMM0619 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAE19078
CYORF: PMM0619
UniProt: Q7V267
Position
589700..591682
Genome map
AA seq 660 aa AA seqDB search
MTLDKKHSINNILEENRLFPPSKEFSDKSNIKSFEELQSLKKQSLENPTKFWESFANSEI
DWFEPFQTVLDRENAPFFKWFKEGKLNITYNCLDRHIKNGIGNKTALVWEGEPGDNKKYT
YQELLKEVCKASNALKSLGIKKGDLVCIYMPMIPEAMVAMLACARIGAPHSVVFGGFSSE
SLKDRLIDGNARFVITADGGFRKDKVIELKKAVDAAIESGANKIVEKVIVVQRTKKDISM
VNNRDFWWHELLKDQKDWCEPEIMNSEDRLFVLYTSGSTGKPKGVVHTTAGYNLWSHLTF
KWIFDIKDDDVYWCTADVGWITGHSYIVYGPLSNGATTLMFEGVPRASNLGAFWEIIQKY
KVTIFYTAPTAIRSFMKSGREIPDQYDLRSLRLLGTVGEPINPEAWMWYREVIGDNKCPI
VDTWWQTETGGVMISPLPGAVATKPGSATFSLPGIEVEVVDKNGEKVVENEGGYLVVKKP
WPGMMRTIHENSQRYLESYWEYISFKGEKNVYFAGDGARIDNDGYIWIMGRVDDVISVSG
HRLGTMEIESALVSHKSVAEAAVVGRKDDLKGEAIVAFVSLEKDINSFPEIVEELKKHVV
NEIGIIAKPEKIIISDSLPKTRSGKIMRRILRSLAEGEKISGDISTLEDSSVLEKLKEIS
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgacattagataagaaacattcaatcaacaatattcttgaagaaaatagactcttcccc
ccttcaaaagaattctcagataaatcaaatataaaaagttttgaggaattacaaagttta
aaaaaacaatctttagagaacccaacaaaattctgggaatcttttgcaaattcggaaatt
gattggttcgaaccatttcagactgttttagaccgagaaaatgcgcccttttttaaatgg
tttaaggaaggtaagttgaatatcacttataactgcttagatagacatatcaaaaacgga
attgggaataaaacagcgcttgtatgggaaggcgagccaggagataacaagaaatatacg
tatcaagaacttctcaaagaagtatgcaaagcttcaaatgctttgaaatctttgggaata
aaaaagggtgatttggtctgtatttatatgccaatgattcctgaggcgatggttgccatg
ctcgcttgcgcgagaattggagctcctcattccgtagtttttggaggcttctcctctgag
tcgttaaaagataggttaattgatggaaatgccagatttgttataacggcagatggtggt
tttagaaaagataaggtaattgagcttaagaaagctgttgatgcggcaattgaaagtggg
gcaaataagattgttgaaaaagttattgttgttcaaagaactaaaaaagatatctcgatg
gtaaacaatagggatttttggtggcacgaattattaaaagatcaaaaagattggtgtgaa
cctgaaattatgaatagcgaagatagattgtttgtcttatatacttcaggatccactggt
aaaccaaagggtgttgttcatacaactgctggttataatctctggtctcaccttacattc
aagtggatttttgatataaaagatgatgatgtctattggtgtacagcagatgttgggtgg
attactggacatagttatatagtatatggacctttatccaatggagcaacaactcttatg
tttgaaggtgttccaagggcatctaacttaggggctttttgggaaattattcaaaaatac
aaagttactattttctatacagcgccaacagcgataagatcatttatgaaatctggacgt
gaaatccctgaccaatacgatttaagatctttgagacttttggggacagttggcgagcca
attaatcctgaagcatggatgtggtatcgagaggtaataggtgataataagtgtccaata
gtagatacatggtggcaaactgaaactggtggtgtgatgataagcccgttaccaggagcc
gttgctacaaagccaggttccgcaacattctctttgcctggaatcgaggttgaagttgta
gataaaaatggagaaaaggtggtggaaaatgagggtggatatttggttgttaaaaaacct
tggcctggaatgatgcgtacaattcatgaaaactctcaaagatatttagaaagttattgg
gaatatatttcttttaaaggtgaaaaaaatgtttatttcgctggtgatggggctcggatt
gataatgatggatatatttggattatgggaagagttgatgatgttataagtgtttccggg
catcgtttgggaactatggagatagagtccgcattagtaagtcataaatcagttgcggaa
gctgctgttgtcggaagaaaagatgatttaaaaggtgaggctattgttgcatttgtatct
ttagaaaaagatataaatagttttccagaaatagttgaggagttaaagaaacatgtagtt
aatgaaattggaattattgctaaaccagaaaaaataataatttcagattctcttccaaaa
acgcgtagtggaaaaataatgagaagaattttgagatccttggcagaaggcgaaaaaata
agtggagatattagtactcttgaagatagttctgttttagaaaaattaaaggaaatatct
taa

DBGET integrated database retrieval system