KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM0830Help
Entry
PMM0830           CDS       T00142                                 

Gene name
folP
Definition
(GenBank) putative dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00790  Folate biosynthesis
pmm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PMM0830 (folP)
Enzymes [BR:pmm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PMM0830 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind QRPTase_C LysR_substrate CAT_RBD
Motif
Other DBs
NCBI-ProteinID: CAE19289
CYORF: PMM0830
UniProt: Q7V1N3
Position
785324..786166
Genome map
AA seq 280 aa AA seqDB search
MQISNNNYPWPDDWGRKTSIMGIINLTPDSFSDGGDFCSIEKVLNQVNYFVSNGVDVIDL
GAQSTRPGAIEIGAKNESKRLIPYLKKIRSEYPNILISIDTFNSEVAHEALSNGANWIND
VTGGRRDEEILDVVSEFNCPFVITHSRGNSITMNNLTNYDDFLVDIIHSLESLTKKALNK
NVSKDKIIWDPGIGFSKDTKQNIEILRNVPLLKNFEFPLLIGASRKRFIGEILNQPNPKE
RDIGTLAISCLCSQQKIHLVRVHNVKINYQVLKVADHIFR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaatttcgaataataactacccttggcctgatgattgggggaggaaaacctccata
atggggattattaatttaactccagattcatttagtgatggaggtgatttttgttccata
gaaaaagttttaaatcaagtaaattattttgtttcaaatggagttgatgtaattgatctt
ggtgcacaaagtactagacccggagcgatagaaattggagcgaaaaatgaatcaaaaaga
ttaataccatatttaaaaaaaattagaagtgaatatcccaatattcttatttctattgat
acttttaattctgaggttgctcatgaagctctctcaaatggtgctaattggattaatgat
gtcacaggtggaagaagggatgaggagattttagatgttgtctcagaatttaattgtcct
ttcgtaattactcatagtcgcggaaatagcataaccatgaataatttgacaaattatgat
gattttttagttgatattattcattctcttgaaagtttgacaaaaaaagctctaaacaaa
aatgttagtaaggataaaataatttgggatccaggtattggattttcaaaggacactaaa
cagaacatagaaatcctaagaaacgtacctcttttaaagaattttgaatttccactccta
attggggcctcaagaaaaagatttattggagaaatcttaaatcaacctaatcccaaagaa
agagatataggaacactagctattagttgtctttgttctcaacaaaaaattcacttagta
agagttcataatgtaaaaatcaattatcaagttttaaaagtcgcagatcacatatttaga
taa

DBGET integrated database retrieval system