KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM1514Help
Entry
PMM1514           CDS       T00142                                 

Gene name
lipA
Definition
(GenBank) lipoic acid synthetase
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00785  Lipoic acid metabolism
pmm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    PMM1514 (lipA)
Enzymes [BR:pmm01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     PMM1514 (lipA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM LIAS_N
Motif
Other DBs
NCBI-ProteinID: CAE19973
CYORF: PMM1514
UniProt: Q7UZY1
Position
complement(1455800..1456693)
Genome map
AA seq 297 aa AA seqDB search
MTNISKNAVTKPDWLRVKAPQVERIGNTANLLSDLKLNTVCQEASCPNIGECFASGTATF
LIMGPGCTRACPYCDIDFDRSKRDLDPTEPDRLAEAVFRLKLKHVVITSVNRDDLDDGGA
SQFYKCVSEVRKKSPETTIELLIPDLCGNWSALEKILDSRPNVLNHNIETVSALYRKVRP
QGNYQRTLELLKRTREYFPSVYTKSGFMLGLGEKDDEVLTLLMDLRKNDVDIVTIGQYLS
PGPKHLQVQRFVTPSKFNYFKLFGENELGFMQVVSSPLTRSSYHAEEIQKLMKKFPR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
ttgactaatatttccaaaaatgcagttacgaagcctgactggttaagagtaaaagcacct
caagttgagagaatagggaatactgcaaatttattgagtgatttaaaattaaatactgta
tgccaagaagcaagctgtcctaatattggcgaatgttttgctagcgggactgcaactttt
ttaattatgggaccaggttgtactagagcatgtccatattgtgatattgattttgataga
tccaagagagatttagacccaacagaaccagatcgtttagcagaggctgtttttagatta
aaacttaaacatgttgtgattacctcagttaatagagatgatctagatgatggtggagct
tctcagttttataaatgtgtttctgaagttagaaaaaaatctcctgaaacaactattgaa
ttattaattccagatttatgtggtaactggtcagcacttgaaaagattttagattctaga
ccaaatgttttaaatcataatattgaaactgtctcagctttgtataggaaagtaaggcca
caaggaaactatcaaagaactttagagttactaaaaagaacaagagaatatttcccaagt
gtttatactaaatctggattcatgttgggattaggagaaaaggatgatgaagttcttact
cttctaatggatttaagaaaaaatgatgtagatatagttactattggtcaatatttatct
ccaggcccaaaacatcttcaggtccaaagatttgttaccccttcaaaatttaattatttt
aaattatttggagaaaatgaattagggtttatgcaagttgtcagttctcctttaactcgt
agtagttatcatgctgaagagattcagaaactcatgaaaaagtttccaagataa

DBGET integrated database retrieval system