KEGG   Prochlorococcus marinus NATL2A: PMN2A_0008Help
Entry
PMN2A_0008        CDS       T00267                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00260  Glycine, serine and threonine metabolism
pmn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmn01100  Metabolic pathways
pmn01110  Biosynthesis of secondary metabolites
pmn01130  Biosynthesis of antibiotics
pmn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMN2A_0008
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMN2A_0008
Enzymes [BR:pmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PMN2A_0008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth IGPS ThiG NanE NMO
Motif
Other DBs
NCBI-ProteinID: AAZ57500
CYORF: PMN2A_0008
UniProt: Q46LX8
Position
558019..558834
Genome map
AA seq 271 aa AA seqDB search
MKSTNISRSFSKIKKEKRIALMPFLMAGDPDLETTAKILLELQANGADMIELGIPYSDPL
ADGPIIQLAASRALSAGTSPDRVFKMLFELRDQLTIPIILFTYSNPLINKGLEEFCLQAS
KVGVSGLVVPDLPLEEAEKLSDIAESKEIDLVLLVAPTTPKDRMKRIAATSNGFTYLVSV
TGVTGERSSLEDNVGSLVQQLKDSSSSPIAVGFGISDVKHIEQVREWGADGAIVGSALVK
RIANASIEMKVEEAGSFCKELRAATNEYFFK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagtacaaatatcagtaggtctttttccaaaataaaaaaggagaaaagaattgca
ctaatgcctttccttatggcaggtgaccctgatttggaaactacagcaaagattttgtta
gagcttcaggcaaatggcgctgacatgattgagctaggcattccatacagtgatccttta
gcagatggtccgattattcaattagcagcttctcgagctctttctgcaggaacctcccct
gacagggtttttaaaatgttgtttgaattgagagatcaattgacaataccaataatttta
tttacttactcaaacccacttattaataaaggtctggaagaattttgcttgcaagcatcg
aaagtaggtgtttcaggacttgtcgtaccagatcttcctctagaggaagcagaaaaactt
tctgatattgctgaatctaaggaaattgatttggttttacttgttgctcctacaacccca
aaggatcgtatgaaaagaatcgcagcgacttctaatggattcacttatcttgtaagtgtt
actggggtgactggagaaaggtcatcattagaagataatgtaggatctcttgtgcaacaa
ctaaaagattcttcatctagtccaattgctgtgggctttggaatttcagatgtaaaacac
attgaacaagttagagaatggggcgctgatggcgcaattgttggtagtgctttagttaaa
agaattgctaatgcctcgatcgaaatgaaagtcgaagaagctggttctttttgtaaagaa
ctaagagccgcaactaatgaatatttttttaaatag

DBGET integrated database retrieval system