KEGG   Prochlorococcus marinus NATL2A: PMN2A_0032Help
Entry
PMN2A_0032        CDS       T00267                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00010  Glycolysis / Gluconeogenesis
pmn00052  Galactose metabolism
pmn00500  Starch and sucrose metabolism
pmn00520  Amino sugar and nucleotide sugar metabolism
pmn00521  Streptomycin biosynthesis
pmn01100  Metabolic pathways
pmn01110  Biosynthesis of secondary metabolites
pmn01120  Microbial metabolism in diverse environments
pmn01130  Biosynthesis of antibiotics
pmn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMN2A_0032
   00052 Galactose metabolism
    PMN2A_0032
   00500 Starch and sucrose metabolism
    PMN2A_0032
   00520 Amino sugar and nucleotide sugar metabolism
    PMN2A_0032
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PMN2A_0032
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PMN2A_0032
Enzymes [BR:pmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PMN2A_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AAZ57524
CYORF: PMN2A_0032
UniProt: Q46LV4
Position
complement(584817..585842)
Genome map
AA seq 341 aa AA seqDB search
MNLLAGDLGGTKTILAIYSNEKYPKKLFEKYYISSEWKSFYSLFEDFIKHLPDHISLPQN
GSIGVAGPIQNQEVKITNLGWDIESKKLSLLSKINNIELINDFSVLIYGIPFFNRNQYEV
IQGTLNSDYKNNQKLIAIIGAGTGLGMSRGLITPKSISIFPSEGGHREFSPRTENEWALV
KWLKKKLNIQRISIERIVSGTGLGMIARWKLDDPINESHPLQVILKNMDSDKSDSTDLPA
LVWEKAKNGDKLMTEALQLWLNAYGSAAGDLALQELCSSGLWIAGGTAAKNLDGINSSNF
LSAFSNKGRFQSYLKEIPLVVLKDKEATLFSSACRARLIAE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacttgctggagaccttgggggaactaaaacaatattagctatttattcaaac
gagaaatatccaaaaaaattatttgagaagtactatatttcatcagaatggaaatctttt
tactcattatttgaagattttattaaacatttaccagatcatatatcactgcctcaaaat
ggttctattggtgtagccgggccaatacaaaatcaggaggttaagattacaaatcttggc
tgggatatcgaatcaaaaaagttatctctactttcaaaaataaataatattgaattaata
aatgatttttcagttttaatctatggaataccatttttcaatagaaaccaatatgaagta
atacaagggacattaaattctgattacaaaaacaatcaaaaattaattgcaattatcgga
gctggtactggcttaggaatgtccagaggcttgataacccctaaaagcatctctatattt
ccaagtgaaggagggcatcgagaattttccccaagaacagaaaacgaatgggcattagtc
aaatggctaaaaaagaagttaaatattcaaagaatatccattgaaagaattgttagtggt
actggccttggcatgattgccagatggaaattggatgatccaataaatgaaagccatcca
cttcaggtaattttaaaaaatatggatagtgacaaatcagattccacagatttacccgca
cttgtttgggaaaaagcaaaaaacggagacaaattaatgactgaagccttgcaactatgg
ctaaatgcttatgggtctgcagctggagaccttgctttacaagaactttgctcttcaggc
ttatggatagcaggtggaacagcagcaaaaaacctcgatggaataaactcttctaacttc
cttagtgcatttagtaataagggtcgctttcaatcttatttaaaggaaattccattggtt
gttcttaaagataaagaagcgacattattcagctcagcttgcagagcacgcttaattgcc
gaataa

DBGET integrated database retrieval system