KEGG   Prochlorococcus marinus NATL2A: PMN2A_0235
Entry
PMN2A_0235        CDS       T00267                                 

Definition
(GenBank) putative multidrug efflux ABC transporter
  KO
K01992  ABC-2 type transport system permease protein
Organism
pmn  Prochlorococcus marinus NATL2A
Brite
KEGG Orthology (KO) [BR:pmn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmn02000]
    PMN2A_0235
Transporters [BR:pmn02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    PMN2A_0235
SSDB
Motif
Pfam: ABC2_membrane_6 ABC2_membrane
Other DBs
NCBI-ProteinID: AAZ57727
CYORF: PMN2A_0235
UniProt: Q46LA1
Position
783508..784305
AA seq 265 aa
MRIFGLSFKVIKTLLTTQYAYMLEYRIEIALWALSGVLPFIMFSLWSQNDVGNSFGLNDI
GLARYFLSAFLVRQFSVVWVVFSFEEDSLSGRLSPYLLQPLHPLFRYVASHLAEQATRLP
FAIAIAITFFILNPSSFWLPSLPQLFLAYLSTHFAFTIAFLLQSLVAALCFWTEKSSALE
RLIFVPYLFLSGLLVPLSAFPSNVLKVAMLTPFPYLINFPAKILSGMPVDIFNGFLAQIL
WISILVPSVNILWKLGVKRYTAMGA
NT seq 798 nt   +upstreamnt  +downstreamnt
ttgagaatatttggattgtctttcaaggtcattaagaccttacttacaacgcaatatgca
tacatgttggaatatcgcatcgaaatagctttgtgggctctttctggagtactaccattt
attatgttttctctttggagtcaaaatgatgttggcaattcatttggtctaaatgatata
gggttggcaagatattttttaagtgcttttctagttaggcaattttcagttgtttgggtt
gtcttctcgtttgaggaagattctctttctggtcgattatctccatatttgctgcagcct
ttgcaccctctatttagatatgttgcttctcacttggcagagcaggcaacaagacttcct
ttcgcaatagccatagctattactttttttatattaaatccatcatctttttggcttccc
tcactacctcaattgtttttggcgtatttatcaactcacttcgcttttactattgctttt
cttcttcaaagtttagtcgctgcactttgcttttggactgaaaaatctagcgctcttgag
agattaatatttgttccttatctttttctttctggtttattagtacctttatcagccttt
ccttctaacgttctaaaagtagcaatgttaacgccatttccctatctaattaattttcca
gcaaagattttatctgggatgccagttgatatttttaatggctttttagctcagattttg
tggatttcaatactggtaccttctgtaaatattctttggaaacttggcgtaaagagatat
acagcaatgggagcctaa

DBGET integrated database retrieval system