KEGG   Prochlorococcus marinus NATL2A: PMN2A_0240
Entry
PMN2A_0240        CDS       T00267                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pmn  Prochlorococcus marinus NATL2A
SSDB
Other DBs
NCBI-ProteinID: AAZ57732
CYORF: PMN2A_0240
UniProt: Q46L96
Position
complement(787840..788007)
AA seq 55 aa
MEGFDPAINYGPNDAGISALTIVLGIIGLIAISWLFGKIYEQLAKLFEGNKKNES
NT seq 168 nt   +upstreamnt  +downstreamnt
gtggaaggatttgacccagctataaattatggtccaaatgatgcaggtatatcagcacta
acaatagttttaggaattattggtcttattgctatttcatggctatttgggaaaatatat
gaacaattagctaaattgtttgaaggcaataaaaagaatgaatcttaa

DBGET integrated database retrieval system