KEGG   Prochlorococcus marinus NATL2A: PMN2A_0241
Entry
PMN2A_0241        CDS       T00267                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pmn  Prochlorococcus marinus NATL2A
SSDB
Other DBs
NCBI-ProteinID: AAZ57733
CYORF: PMN2A_0241
UniProt: Q46L95
Position
788145..788432
AA seq 95 aa
MKWEYQVIHLNVDNSSSKSEESSNPEAASEKLKGSLSPDFLKDQFPEQYQENEGSEHPAI
QLSKFLNKKGLDSWELSETLKIGKMLFLIMKRPVE
NT seq 288 nt   +upstreamnt  +downstreamnt
atgaagtgggagtaccaagtaatccatctcaatgtagacaattcgtcaagtaaaagcgaa
gaatcaagcaatcctgaggccgcaagtgaaaaacttaagggttcactaagtccagatttt
ctaaaagatcaatttccggagcaatatcaggaaaatgaaggctctgagcatcctgctatt
caactaagtaaatttctaaataaaaagggacttgatagttgggaactttctgaaacatta
aaaattggaaagatgttatttcttatcatgaaacggccagttgaataa

DBGET integrated database retrieval system