KEGG   Prochlorococcus marinus NATL2A: PMN2A_0260
Entry
PMN2A_0260        CDS       T00267                                 

Definition
(GenBank) anti-anti-sigma regulatory factor
  KO
K04749  anti-sigma B factor antagonist
Organism
pmn  Prochlorococcus marinus NATL2A
Brite
KEGG Orthology (KO) [BR:pmn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pmn03021]
    PMN2A_0260
Transcription machinery [BR:pmn03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     PMN2A_0260
SSDB
Motif
Pfam: STAS STAS_2 LEF-9
Other DBs
NCBI-ProteinID: AAZ57752
CYORF: PMN2A_0260
UniProt: Q46L76
Position
803700..803999
AA seq 99 aa
MINFTGQLDAYSEKQFTTYINEVLASNQLSVVIDLSNIDFIDSCGLGAMVQAAKKCTESK
RSFNVVGNPRVTQTIKLVRLEEYLHLAPDLSTAIGKLSA
NT seq 300 nt   +upstreamnt  +downstreamnt
gtgattaatttcactggtcaactagatgcttattcagagaaacaattcacaacatatatc
aatgaagttttagcttctaatcagctatcagttgtaattgatttatctaatatcgatttc
attgattcttgtggcttaggtgcaatggttcaggccgctaagaaatgtactgagtcaaaa
agatcatttaatgttgtaggaaatcctagagtaactcagacaattaaacttgttcgcttg
gaggaataccttcatctggcacctgatctaagtaccgcaattggtaaattatcagcttga

DBGET integrated database retrieval system