KEGG   Prochlorococcus marinus NATL2A: PMN2A_0322Help
Entry
PMN2A_0322        CDS       T00267                                 

Definition
(GenBank) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00300  Lysine biosynthesis
pmn01100  Metabolic pathways
pmn01110  Biosynthesis of secondary metabolites
pmn01120  Microbial metabolism in diverse environments
pmn01130  Biosynthesis of antibiotics
pmn01230  Biosynthesis of amino acids
Module
pmn_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pmn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    PMN2A_0322
Enzymes [BR:pmn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     PMN2A_0322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase
Motif
Other DBs
NCBI-ProteinID: AAZ57814
CYORF: PMN2A_0322
UniProt: Q46L14
Position
862902..863756
Genome map
AA seq 284 aa AA seqDB search
MKNNFSKYQGLGNDFIIFDARSNNLDHLFSKNKDNFIEHLCNRNFGIGADGIILILESNN
KCFVRMKIYNSDGSEPEMCGNGIRCLIAFLNDNNEINELSEIPIETKAGLILTYIDGNEN
IKVNMGEPILSPLDIPTKLLMNSLKVPNGVITLKDQILNVYAASMGNPHMIVFVNDIEGI
PFQEWGSFLEKHNTFPNDTNVHFVEIIDKSNIKVKVWERGCGPTLACGTGACACLVVTSK
LGKTLNNANVYLPGGKLEVEWPNQSGPVFMQGPALKVFSGEIDI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataatttttcaaaatatcaaggacttggtaatgattttattatctttgatgct
cgtagtaacaatttagaccatttattttcaaaaaataaagataattttattgagcaccta
tgtaatagaaatttcggcatcggagctgatggtattattcttatattagagtctaataat
aaatgttttgtgagaatgaagatttataattctgatggatctgagccagaaatgtgtggc
aatggtattagatgtctgattgcttttttgaatgataataatgaaattaatgaattgtct
gagatccccattgagaccaaagcgggtcttattcttacttatattgatggtaatgaaaat
ataaaagtaaatatgggtgaacctattctttctcctttagatatacccacaaaattgttg
atgaacagtttaaaagttcctaatggtgtgattacattaaaagatcaaatattaaatgtt
tatgctgctagtatgggcaatcctcatatgatcgtatttgttaatgatattgaagggata
ccatttcaagaatggggtagtttcctagaaaaacataatacattcccaaacgataccaat
gttcactttgttgaaataatcgataagtcaaatattaaagtaaaggtatgggaaaggggt
tgcggcccaacattagcttgtggtactggagcatgcgcttgtctagtagttacctctaag
ctagggaaaactttaaacaatgctaatgtctatttaccaggcggcaaattagaagttgag
tggccaaatcagtcaggtcccgttttcatgcaaggaccagctttaaaagtatttagtgga
gagatagatatttaa

DBGET integrated database retrieval system