KEGG   Prochlorococcus marinus NATL2A: PMN2A_0328
Entry
PMN2A_0328        CDS       T00267                                 

Definition
(GenBank) Excinuclease ABC subunit C
  KO
K03703  excinuclease ABC subunit C
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pmn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    PMN2A_0328
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pmn03400]
    PMN2A_0328
DNA repair and recombination proteins [BR:pmn03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     PMN2A_0328
SSDB
Motif
Pfam: UvrC_HhH_N HHH_2 GIY-YIG HHH_5 UVR HHH
Other DBs
NCBI-ProteinID: AAZ57820
CYORF: PMN2A_0328
UniProt: Q46L08
Position
867862..869784
AA seq 640 aa
MELTPLIRDKSRLSDFLKDIPNDPGCYLMKDGEDRLLYVGKSKKLRNRVRSYFRSGNELS
PRISLMVRQVADIELIVTDNESEALTLESNLIKSHQPYFNVLLKDDKKYPYVCITWGDKY
PRIFLTRKRRQRQLKDKYYGPYVDVYLLRQTLFSIKKLFPLRQRRIPLYKDRTCLNYSIG
RCPGVCQEEISSEDYKNTLKRVEMIFQGRTDELRILLEKQMISFSESLKFEEAGSVRDQL
KGIDRLYESQKMIIPDSSVCRDIIAMASEENISSVQIFQMRSGKLIGRLGYFSDNSNFNS
SQILQQVIENHYSNVDPVEIPSEILVQHQLVNNILISDWLSEIKKQKVNINVPKRSRKAE
IIKLVEKNANLELQRIKQSQDKNLVELDDLTNILDLENIPKRIECYDISHIQGSDAVASQ
VVFIDGIAARQHYRRYKIKSPNIKIGHSDDFESMAEVITRRFRRWARFKEEGGDIDALLS
NESSVLDNLNLNDWPDLVVIDGGKGQLSSVVAALEGLKLDQNLNVISLAKKKEEVFIPKV
KQSLVTESNQPGMLLLRRLRDEAHRFAITFHRQKRSQRMKRSQLNEIPGLGPQRIKLLLE
HFRSIEAIQMATFSELSSTPGLGRSTAVVIRNYFHPDKNI
NT seq 1923 nt   +upstreamnt  +downstreamnt
gtggaactaacaccgttaataagggacaagtcaagattatcggattttttaaaggatata
cctaatgatcctggatgttatttgatgaaagatggtgaggatagattgctttatgttggt
aaatctaaaaagttaaggaatagagttagaagttattttcgttcaggtaatgaattaagt
cctagaatatctttaatggtgagacaagttgcagatattgaattgattgttactgataat
gaaagtgaagcattaacattagaatcaaatttaattaaatctcatcaaccatatttcaat
gttttactaaaagatgataaaaagtatccctatgtttgcattacatggggtgataaatat
ccaagaatatttttaactagaaaaaggcgtcaacgacaattaaaagataaatattatggt
ccttatgtagatgtttatttacttagacagactctatttagtataaaaaaattgtttcca
ctcaggcaaagaagaattccactttataaggatagaacatgccttaattattcaattgga
agatgtcctggtgtttgtcaggaagaaataagttcagaagattataaaaacactttaaaa
cgtgttgaaatgatatttcaaggaagaacagatgaattaagaatattattagaaaaacaa
atgatttctttttcagagtcattgaaatttgaagaggctggatcagttagagatcagctt
aagggtatagatagattgtatgaatctcaaaagatgattattcctgattcatctgtttgt
agggatataattgcaatggcatcagaagaaaatataagctcagtacaaatttttcaaatg
cgatcaggtaaattaattggtcgtttaggatatttctcagataatagtaattttaattca
tctcaaatacttcaacaagtaatagaaaatcattattcaaatgtagatcctgttgaaatc
ccatcagaaatattagttcaacatcaacttgtaaataatattttaatttcagattggctt
agtgaaataaaaaaacaaaaagttaatataaatgttcctaaaagatctagaaaagcagag
attattaaactcgtagaaaaaaatgctaatttagaattacaaagaattaaacaatctcag
gataagaatttagttgaacttgatgatctgactaatatccttgatttagaaaatattcca
aagagaattgaatgttatgacataagccatatccaaggaagtgatgctgttgcatcacaa
gtagtatttattgatggtattgcggcaaggcaacactatagaagatataaaattaaaagc
ccgaatataaaaattggtcatagcgacgatttcgaatcaatggctgaagtgataactaga
agatttagaagatgggctcgttttaaagaagaaggtggagatattgatgccctattaagt
aatgaaagcagtgttcttgataatctgaatttaaatgactggccagatctcgttgtgata
gatggaggtaaaggtcaattaagttctgtcgtagcagctcttgagggcctgaaacttgat
caaaatttaaatgtcatttctttagcaaaaaagaaggaggaagttttcattccgaaggtt
aaacaatcattagttaccgaatcaaatcaaccaggaatgcttttgctaaggagactgaga
gatgaggctcatagatttgcaattacttttcatagacaaaaaaggagtcaacggatgaaa
cgttctcagttaaatgaaataccgggtcttggacctcaaagaataaaattattgcttgag
catttcaggtcaattgaggcaattcaaatggctactttttctgaactttcatcaacacca
ggcttaggcagatcaactgctgttgttattagaaactattttcatcccgataaaaatata
taa

DBGET integrated database retrieval system