KEGG   Prochlorococcus marinus NATL2A: PMN2A_0390
Entry
PMN2A_0390        CDS       T00267                                 

Definition
(GenBank) NADPH-dependent reductase
Organism
pmn  Prochlorococcus marinus NATL2A
SSDB
Motif
Pfam: NmrA NAD_binding_10 3Beta_HSD Epimerase TrkA_N DapB_N
Other DBs
NCBI-ProteinID: AAZ57882
CYORF: PMN2A_0390
UniProt: Q46KU6
Position
936124..937161
AA seq 345 aa
MLEQVKILESEAKEKLVVAVTMATGRQGIGVVKELSQTDKYQIRAITRNIKSTKALELGS
LNNVELVKGDLMDPESLKKAFEGVDVIFGNTTPTKGWKIFRGSIVRSYEMEQGYNLINQV
KTAYEKGHLNHFIFSSISKAKDPLKNDPAPGHFTSKWDIEEYIEKSGLKKITTVLRPVSY
FENFENKLPGYTISKNIFPGIVGKNFKWQTIAVEDIGKWVRGVLSKSEKYKNQSINIAGE
ELTGLEMAMTLQKIVSSEGIKTNYVMIPRLAIKLLEFDIGVMADWIERSGYGADMNNLQS
IQKELNISPTSLKDWLKTKLKRQNKKQNSWAREWKSSQWKLQWDK
NT seq 1038 nt   +upstreamnt  +downstreamnt
gtgcttgagcaagtaaaaattttggagtcagaggcaaaggaaaagctcgttgtagcagta
actatggccacaggtaggcaaggtattggtgtcgttaaagaattaagccaaacagataaa
taccaaatacgtgctatcacaagaaatataaagagtacaaaggctctagagctaggaagc
ctaaacaacgttgaactagtcaagggagatttaatggatcctgaaagccttaaaaaagct
tttgaaggagtagatgtgatttttggaaatacaacacctacaaaaggatggaaaattttt
agaggcagtatcgtcagatcctatgaaatggagcaaggttataacttaataaatcaagtc
aaaactgcctacgaaaaaggacacctaaatcactttatatttagctcaattagtaaagca
aaagacccactaaaaaatgatccggctccaggacattttacgagtaaatgggatattgaa
gaatatatagaaaaatcaggtcttaaaaaaattactactgttttaaggcccgttagctac
tttgaaaactttgaaaacaaattacctggctatacaatttcaaagaacatttttccagga
atagttggcaagaattttaagtggcaaacaatcgcagtagaagatataggtaaatgggtt
agaggtgttttatcgaaatcagagaaatataaaaatcaatctatcaatattgccggcgag
gaactaacaggactggaaatggctatgacgcttcaaaaaatagtttcttcagaaggaata
aaaacaaattatgtaatgatccctagattagcaattaagttattggaattcgacattggc
gttatggctgattggattgaaagatcagggtatggagctgatatgaataatcttcaatcg
attcagaaagagttaaatatttctcctacatcacttaaagactggctaaagacaaaactt
aaaagacaaaataagaaacaaaattcatgggcaagggagtggaaatcatctcaatggaaa
cttcaatgggataaataa

DBGET integrated database retrieval system