KEGG   Prochlorococcus marinus NATL2A: PMN2A_0408
Entry
PMN2A_0408        CDS       T00267                                 

Definition
(GenBank) hypothetical protein
Organism
pmn  Prochlorococcus marinus NATL2A
SSDB
Motif
Pfam: T5orf172 MUG113 GIY-YIG
Other DBs
NCBI-ProteinID: AAZ57900
CYORF: PMN2A_0408
UniProt: Q46KS8
Position
complement(948461..949003)
AA seq 180 aa
MSGWLYLIRNKDLYKIGITKNFENRMRQLKPDNVVAKLYTADFVKLERELHNRYKKFRIP
QTEYFRLENTHIKEIKKRISILNYPFILTFGICLKSILLLLLFFFLTLVVISLYINDLNI
AISKSLVWIERISFGLAFISLFVYSGKYLSFWNELKYRSTRLIIFLFFSFLFRLVAIFLS
NT seq 543 nt   +upstreamnt  +downstreamnt
atgagtggttggctttacttaataagaaataaagatctatataagattggcataacaaaa
aactttgagaataggatgagacaactcaagccagataacgttgttgctaaattatatact
gctgattttgtgaaattagaaagagagttacataatcgctataaaaagttcagaatccct
caaactgagtattttagattagaaaacactcatattaaagagataaaaaaaagaatttcc
atacttaattatccttttattttaactttcggaatttgtttaaaatcaatattattatta
ttattatttttttttcttacattagtagttatatctttatatattaatgacttaaatatc
gctatatctaagtcacttgtttggattgagcgaatttcatttggactagcctttatttct
ttatttgtttattcaggtaaatatttaagtttttggaatgaattaaaatatagatccact
agattaattatttttcttttcttttctttcttatttcgtcttgtcgctatctttctctct
tga

DBGET integrated database retrieval system