KEGG   Prochlorococcus marinus NATL2A: PMN2A_0698Help
Entry
PMN2A_0698        CDS       T00267                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00860  Porphyrin and chlorophyll metabolism
pmn01100  Metabolic pathways
pmn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMN2A_0698
Enzymes [BR:pmn01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PMN2A_0698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_22 AAA_16 Sigma54_activat AAA_29 AAA AAA_18 DUF815 ABC_tran AAA_30 AAA_28 AAA_33 SHS2_FTSA MMR_HSR1 AAA_14
Motif
Other DBs
NCBI-ProteinID: AAZ58189
CYORF: PMN2A_0698
UniProt: Q46JY9
Position
1195425..1196513
Genome map
AA seq 362 aa AA seqDB search
MSSTRKRRVFPFTSVIGQEEMKLALLLNVIDPRIGGVMIMGDRGTGKSTTIRALADLLPA
IEVVEGDPYNSSLEDPDLQSNDVRERIDSGSDIQKGEKQVPMIDLPLGATEDRLCGTIDI
EKALSEGVRAFEPGLLAKANRGLLYVDEVNLLDDHLVDVLLDSAASGWNTVEREGISVRH
PARFVLIGSGNPEEGELRPQLLDRFGMSVEVRTVREAKLRVQVVDQRTAFDNDPESFSDS
VQEKQESLQQKVVDAQNILNEVFIEEDLRLRISAVCGELDVDGLRGDIVTNRAARALAAF
EGRKEVTEEDIARVVSTALRHRLRKDPLEQVDSGDRVIKAFCKVFERNESDDVSEFELAT
AN
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcaacaagaaaacgcagagtttttccattcacttcagtgattggacaagaggaa
atgaagctagcgcttctcttaaatgtaattgaccctagaattggcggagtaatgataatg
ggtgatagaggcacaggcaagtccacaaccataagagcacttgcagatctattacctgca
attgaagtcgttgaaggagatccctacaacagctctcttgaggatccagaccttcaaagc
aatgatgtcagagagagaatagacagtggtagtgacattcaaaaaggtgaaaaacaagtt
ccgatgattgatctacccttaggtgccactgaggatagactttgcggaactattgatatt
gaaaaggcccttagtgagggagttagagcttttgagccaggactactagccaaagcaaac
agagggttgctttatgttgatgaagtcaacttgctagatgatcaccttgttgacgtactt
ttagactctgctgcatcaggctggaatacagttgaacgagaaggtatttcggttcgacat
cctgcaaggtttgtacttattggttcaggaaatcctgaggaaggagagttaaggcctcag
ttacttgatcgttttgggatgagtgtagaggtaagaacagtaagggaggcaaaactacga
gttcaagttgttgatcaacgtacagcttttgataatgatcctgaatcttttagcgattca
gttcaagagaaacaagaatcacttcaacaaaaggttgttgatgctcaaaatatacttaac
gaggtttttatcgaggaagatctcagattaaggatttcagcagtttgtggtgaacttgat
gttgatggacttagaggagatatcgtaacaaatagagcagctagagcccttgctgccttt
gaagggagaaaagaagtaaccgaagaagatattgctcgtgtcgtgtcgacagctttaagg
cataggcttcgaaaagatcctcttgaacaagttgattctggagatagagtaataaaagct
ttttgcaaagtatttgaaaggaatgaaagtgatgatgtatctgaattcgaactagccaca
gctaactaa

DBGET integrated database retrieval system