KEGG   Prochlorococcus marinus NATL2A: PMN2A_1546Help
Entry
PMN2A_1546        CDS       T00267                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00270  Cysteine and methionine metabolism
pmn00480  Glutathione metabolism
pmn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PMN2A_1546
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PMN2A_1546
Enzymes [BR:pmn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     PMN2A_1546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD Adenyl_cycl_N
Motif
Other DBs
NCBI-ProteinID: AAZ59034
CYORF: PMN2A_1546
UniProt: Q46HJ4
Position
complement(216422..217351)
Genome map
AA seq 309 aa AA seqDB search
MKQLFVLDPIENINPKKDSSAALMQAASRADIDVWICTPSDLQARGDDAWVVSNKVNCEP
WINVQSSRSLPLRDFSCIWMRKDPPVDEAFLYATHLLEVAERDGVNVINKPASLRAWNEK
LGALRFSNLMAPTLVASRVEQLITFAKEYGEVVLKPLGGKGGQGVIRIAKDAPGLEALLE
LVTSQEHLPVMMQQFLPEVINGDKRILLVNGEPLGAINRRPKEGDFRSNLALGGKAETTK
LTPKEIEICNQIKPALQEEGLFFVGIDVIGGMLSEINVTSPTGIREVESLMNVPLADQVI
DYLIDHLNN
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactatttgttttagatccaattgaaaatattaatcctaagaaggattcatca
gcagcacttatgcaagccgcatcaagagccgacatagatgtttggatctgtactccctcg
gacctgcaagcccgaggagacgatgcatgggtcgtttctaacaaggtcaattgtgaacca
tggatcaatgtccagtcatctcgaagccttcctttaagagatttctcatgcatttggatg
cgcaaagatccacctgttgacgaggcttttttatacgccactcatttattagaagttgca
gaaagagatggtgtcaatgtaattaacaagcctgcatcacttagagcttggaatgaaaag
ttaggagctttaagatttagtaatttaatggctcccactcttgttgcaagtagggtggaa
caattaattacatttgcaaaagagtatggagaagttgtgttaaaaccacttggaggaaaa
ggtgggcaaggagtcatacgaattgcaaaggatgctccaggcttagaagcattactcgaa
ctggttacttcacaagaacatttgccagtgatgatgcaacaattcctaccagaagtaatc
aatggcgataaaagaatccttttggttaatggagagccattaggtgcaattaatagacgt
ccaaaggaaggagacttcagaagcaacttggctttaggtggaaaagctgagacaactaaa
ttaactcctaaagagatagagatatgtaatcaaataaagcctgctttacaagaggaaggt
ctcttttttgtcggaatagatgtgatcggaggaatgctaagtgagattaatgtgacgagt
ccaactggtattagagaagtagaaagtctaatgaatgttccattagcagatcaagtaatt
gattaccttatagatcatttgaacaattaa

DBGET integrated database retrieval system