KEGG   Prochlorococcus marinus NATL2A: PMN2A_1983
Entry
PMN2A_1983        CDS       T00267                                 

Definition
(GenBank) Hypothetical protein
Organism
pmn  Prochlorococcus marinus NATL2A
SSDB
Other DBs
NCBI-ProteinID: ABU23916
CYORF: PMN2A_1983
UniProt: A7MDC3
Position
complement(957362..957481)
AA seq 39 aa
MQPSNKTILERSIGRPAMMAFVLLTGIYLTTGQLIPGVV
NT seq 120 nt   +upstreamnt  +downstreamnt
atgcaaccatctaacaaaacaatcctagaaagaagcatcggcagaccagccatgatggca
ttcgttcttctaacaggtatctacctaacaaccggtcaacttatcccaggtgttgtttaa

DBGET integrated database retrieval system