KEGG   Prochlorococcus marinus NATL2A: PMN2A_1984
Entry
PMN2A_1984        CDS       T00267                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
pmn  Prochlorococcus marinus NATL2A
SSDB
Other DBs
NCBI-ProteinID: ABU23917
CYORF: PMN2A_1984
UniProt: A7MDH9
Position
959891..960058
AA seq 55 aa
MGIRHKLMIIATTQKASEVIGGVEIFSPMGLTILTIGILFTVGVPLTMILKGKKD
NT seq 168 nt   +upstreamnt  +downstreamnt
ttgggcatacgccataaattaatgattattgctacaactcaaaaagcatcagaagtaatt
ggaggagtagagatcttttccccaatgggattaaccatcctaaccataggaatactattt
acagtaggtgtaccactaacaatgattttaaaaggaaagaaagattaa

DBGET integrated database retrieval system