KEGG   Petrotoga mobilis: Pmob_0620
Entry
Pmob_0620         CDS       T00621                                 

Definition
(GenBank) alanyl-tRNA synthetase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pmo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Pmob_0620
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmo01007]
    Pmob_0620
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmo03016]
    Pmob_0620
Enzymes [BR:pmo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     Pmob_0620
Amino acid related enzymes [BR:pmo01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Pmob_0620
Transfer RNA biogenesis [BR:pmo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Pmob_0620
 Prokaryotic type
    Pmob_0620
SSDB
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD Med9 DUF4974 CoV_NSP15_N
Other DBs
NCBI-ProteinID: ABX31354
UniProt: A9BJE0
Position
671498..674128
AA seq 876 aa
MKYFTSEEIRENFLYFFEKKGHKKLPSSSLIPNDPQLLFTVAGMVPFKPIFWGKVEPTYT
RITTCQKCLRTNDIENVGRTPRHHTFFEMLGNFSFGDYFKKEAIKWAWEFLTEELGLPAE
KLWASVYETDDEAFNIWKDDIKIPENKILRFGKEENWWGPAGQTGPCGPCSEIYFDTGYT
ENCPDQENCTPACDCGRFVEIWNIVFTEYYSDENGNLSPLPRKNIDTGAGFERICAVTQG
KYDNFDSDLFKEIIEEIQRIFGVKFRVNKSKDVSIKVIADHSRAIAFLISEGIIPSNEGR
GYVLRRLIRRAVRHGALLEAKGPFLSSILETVIKKMGKIYPELIEKEALIKDISFMEEEK
FFETMEKGMERLNNIIQNLNNETTLPGKIAFELYDTYGFPLDLTKEILSEKGIEVDEKEF
TELMNKQREMARSASGKVEYDTEKQIYKEIDKFLTPTEFIGYDKLSSTEEVQLIIKGNSI
VPQAQEGDEIELFFPKTPFYAERGGQVSDKGVIYNETFEAEVIHVKPIRNEIISHLVKIK
KGSIKNGERVFLKVDEKKRKATEKNHTATHLLHSALRKVIGEHIRQAGSYVAPERLRFDF
THYEPLTQDQIKQIEYLINEQIQKAIPVNIYLKSLEEAKSMDVIALFEEKYGEVVRIVEI
DDFSRELCGGTHVSNTGEIGLFKILEESSISSGVRRIEAITGFESLNYATELESIMTNLS
KMLDSSRDQIPDKIEGILKTIKNQEKEIKQLQFQLATKNIERLAETPQIIEGEKVVVAQL
ENLEKDVHANTADILLQKLGRGVVILFNKSNNEQVSLVVKVSKDTSKKFHAGNIARKIAS
YLGGGGGGGPTFAQAGGKYANKVKEVIEHINDFMEV
NT seq 2631 nt   +upstreamnt  +downstreamnt
atgaaatattttacctctgaagaaatcagagaaaattttttgtattttttcgagaaaaaa
gggcataaaaagttacctagttcctcattaattcccaacgatcctcaattgttgtttacg
gtggctggaatggtcccttttaaaccaatattttggggaaaagttgaacccacttatacg
agaatcactacatgtcaaaaatgtttaagaacgaacgatatagaaaatgttggaaggacc
cccaggcatcatactttttttgagatgttggggaatttttcttttggggattatttcaaa
aaagaggctataaaatgggcttgggaatttttaacagaagaattaggacttccagcagaa
aaattatgggcttccgtgtatgaaaccgatgacgaggcttttaatatctggaaagatgat
atcaaaatacctgaaaataaaatactaagattcggtaaagaagaaaactggtggggacct
gcaggtcaaaccggtccatgtggcccatgctcagaaatatactttgatacagggtacacc
gaaaactgtccagaccaagaaaattgcactcctgcatgcgattgtggtcgttttgtcgag
atttggaacatagttttcactgaatattattccgacgaaaacggaaacctatccccttta
ccaagaaaaaacattgataccggggcgggttttgaaagaatctgcgcagttactcaaggt
aaatatgataattttgactccgatctattcaaagaaataatagaagaaatacaacgaatc
tttggtgtaaaattcagagtaaataaaagtaaagatgtatcaataaaagtaatagcagat
cactcaagggcgattgcctttctaatatctgaagggattataccatcaaatgaaggaaga
ggctatgttttaaggagattaataagaagggctgtaagacatggagctttgttggaagca
aaaggcccatttttaagcagtatccttgaaacagtgattaaaaaaatgggaaaaatctat
cctgaacttatcgaaaaagaagctttaatcaaagatatttcctttatggaagaagaaaag
ttttttgaaactatggaaaaaggaatggaaaggttaaacaatataattcaaaacttaaac
aacgaaactacattaccggggaaaatagccttcgaactttacgatacatacggatttcct
ttggacctcacaaaagagatattatccgaaaaagggatagaagttgatgaaaaagaattc
acagaactgatgaacaagcaaagagagatggcaagatcagcttcgggtaaagtagaatat
gatacagaaaaacaaatttacaaagaaatcgataaatttttgactccaactgaatttatt
ggttatgataaactaagttcgacagaagaagttcagcttataataaaaggtaatagtatt
gtcccacaagctcaagaaggtgacgaaatcgaactcttcttccctaaaacgcccttttat
gccgaaagaggaggacaagtctcagataagggtgttatctacaatgaaacattcgaagct
gaagttatacatgtcaaacctataagaaatgagataatatctcacctcgtaaaaataaaa
aaaggtagtataaaaaacggagaaagagtatttctaaaagttgatgaaaaaaagcgaaaa
gctacagagaaaaaccatacagcgacacatcttttgcattctgcattaagaaaagtaatt
ggagagcatataaggcaggctggttcatatgtagccccagaaagattaagatttgatttc
acacattatgaacctttgacccaagatcaaataaagcaaatcgaataccttataaacgaa
caaatacaaaaagctatccctgttaacatatacctaaaaagcttagaagaagcaaaaagt
atggatgttatagccttatttgaagaaaaatacggagaagtggtaagaattgtggaaata
gacgacttctcaagagagctctgtggaggcacgcatgtttccaacacaggagaaataggt
ctcttcaaaattttggaagaatcctctatttcatcaggagttagaagaatagaagctatt
acaggttttgaaagtcttaattatgctacagaattggaaagtattatgactaatttatct
aaaatgttggattcatcaagggaccagatacctgataaaatcgaaggtattctaaaaact
atcaaaaatcaggaaaaagaaattaaacaacttcaatttcagttggccacaaaaaatata
gaaagattagctgaaactccacaaatcatagaaggcgaaaaggtggtagtagctcagtta
gaaaacttagaaaaagacgttcatgctaacacggccgatatcctacttcaaaagttaggt
agaggcgttgtgatccttttcaacaagagtaacaatgagcaagtaagtttggtagtaaaa
gtatcaaaagacacttctaaaaagttccacgccggaaacattgcaagaaaaatagcctcc
tatttaggtggcggtggaggcggtggaccaacttttgcacaagccggcggaaaatatgct
aataaggtgaaagaagtgatagaacacataaatgattttatggaggtttaa

DBGET integrated database retrieval system