KEGG   Petrotoga mobilis: Pmob_0825Help
Entry
Pmob_0825         CDS       T00621                                 

Definition
(GenBank) glycoside hydrolase clan GH-D
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00052  Galactose metabolism
pmo00561  Glycerolipid metabolism
pmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Pmob_0825
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pmob_0825
   00600 Sphingolipid metabolism
    Pmob_0825
Enzymes [BR:pmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Pmob_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2 GHL10 Ins134_P3_kin
Motif
Other DBs
NCBI-ProteinID: ABX31549
UniProt: A9BHE0
Position
complement(867975..870116)
Genome map
AA seq 713 aa AA seqDB search
MPINFDKETKRWLLETENMGYVFGLDDDQGKIKNLYWGSKLPRVQDYPEVKDLILMDRYT
WNDEFSVRGEKNNLEHCLKVEYSDGVRDVVLNYKSFEVSGNDLVIRLSDDHYNLSVNLFY
KVIEKYDIIERWVEIENNSNEEIKIEDMKSASLYVENDEKAKLNYLTGMWGSEFHLRREE
INEGSKVLESRVGKTSAYLNPFFAIDYSADEDRGKVYFGELAWSGNWKIVVQKRIYERIA
IIGGINDWDFSYILEPSEKITTPKFMFGFSDEGFTKASQNIHHYQLDYILPKDKAHKLRK
VLYNSWEATTFNVNEENQKILAEKAAKIGVELFVIDDGWFGKRNDDHAGLGDWYVNKEKF
PDGLQPLISYVKTLGMDFGIWVEPEMVNPNSELYRKHPDWVISFPNRPKSLQRNQLMLNL
AREDVKKFIVDFMDNLLTQNDIDFVKWDMNRHVFESGWMQVEPRKQREIWVKYVWNLYDI
WKYLREKHPHVTFENCSSGGGRVDIGLMQYADQVWTSDNTDPFDRLEIQEGFSYAYAPKI
MMGWVTDWGGKDTYPLTYRFHSSMMGSLGIGADLNKFSERDFDLARYQVQFYKEIREIVQ
EGYQFRLSYVTNDRYFAVEYLSKNKDEGVLIYLRNPRRFGLFDRVDVKLKGLENDAVYTV
YEGLQGEEKEMIKLSGKALKERGIIIEDSSKDFFETGKVTHFYSRILRLRKSD
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgcctataaattttgataaagaaacgaagagatggcttttagaaacagaaaatatgggt
tacgtttttggattagatgatgatcaaggaaagattaaaaatttgtattggggatcaaag
ttgccaagggttcaagactacccagaagttaaagatctaattttaatggacagatacacg
tggaacgatgagttttctgtaagaggagaaaagaacaatttagagcattgtttgaaagtt
gagtattccgatggtgttagggatgttgtgttgaattacaaaagttttgaagtgagtggt
aatgatctagtaatcaggttaagcgatgatcattataatttgagcgtaaatcttttctac
aaggttatagaaaagtacgatatcatagaaagatgggttgaaatcgaaaataattctaat
gaagaaataaagatagaagatatgaaatctgcctcgttgtatgttgaaaatgatgaaaaa
gcaaaattaaattatcttacaggtatgtgggggagtgaatttcatttaagaagggaagaa
ataaacgagggaagcaaagttttggaaagtagggttgggaaaacaagcgcctatctaaat
cctttttttgcgatcgattactctgctgatgaagatcgtggaaaggtatattttggtgaa
ttagcctggagtggtaattggaaaatagtagtacaaaaacgtatatatgaaagaatagcg
ataattggggggataaatgactgggattttagttatatattagaaccctcagaaaagatt
actactcctaaatttatgtttggcttttcagacgagggttttacaaaggcgagccagaat
atacatcattatcagctcgattatatactgccaaaagataaagcacacaaattaagaaag
gttttgtacaattcttgggaagccacgacattcaatgtgaacgaagaaaatcaaaaaata
ttggctgaaaaggctgcaaagattggtgtagaactttttgttatagacgatggatggttt
gggaaaagaaacgacgatcatgctgggttaggtgattggtatgtgaacaaagaaaaattc
ccagatggtttgcaacctttgataagctatgttaagaccttgggaatggattttggtata
tgggtagaaccagagatggttaatcctaacagtgaattgtatagaaaacaccctgactgg
gttattagttttccaaatagaccaaaatcacttcaacggaatcaattgatgcttaatttg
gcacgagaagatgtaaaaaagttcatcgtagatttcatggataatcttttaacacagaac
gatatagatttcgtcaaatgggatatgaacagacatgtttttgagtcaggatggatgcaa
gtggaaccacgaaaacaaagagaaatatgggttaaatacgtgtggaacttatacgatatt
tggaaatatttgagagaaaaacatccacacgttacttttgaaaactgttccagcggtggg
ggaagagtggatataggcttaatgcaatatgcggatcaagtatggacaagcgacaacaca
gacccatttgacaggttagagatccaagagggtttttcatatgcatacgcaccgaaaata
atgatggggtgggtaactgactggggaggaaaagatacttatcctttgacatacagattt
cattcatcaatgatgggatctttgggaatcggtgcggatttgaataaattctctgaaaga
gatttcgatttggcaaggtatcaagttcagttttataaagagataagagagatagtacaa
gaaggctatcaattcaggctttcttacgttacaaatgataggtattttgccgtggaatat
ttgagtaaaaacaaagatgaaggtgttttgatatatttaaggaatccaagaaggtttggt
ttgtttgatagggtggatgtcaaactaaaaggtttggaaaacgatgctgtatacactgtt
tatgaaggacttcagggtgaagaaaaagagatgattaaattatctggaaaggcattgaaa
gaaaggggaattataatagaggattcctctaaagatttcttcgaaactggaaaagtaact
catttttatagcagaattttgaggctaagaaagagtgattaa

DBGET integrated database retrieval system