KEGG   Petrotoga mobilis: Pmob_0864
Entry
Pmob_0864         CDS       T00621                                 

Definition
(GenBank) peptide chain release factor 2
  KO
K02836  peptide chain release factor 2
Organism
pmo  Petrotoga mobilis
Brite
KEGG Orthology (KO) [BR:pmo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pmo03012]
    Pmob_0864
Translation factors [BR:pmo03012]
 Prokaryotic type
  Release factors
   Pmob_0864
SSDB
Motif
Pfam: PCRF RF-1 ABC_tran_CTD
Other DBs
NCBI-ProteinID: ABX31587
UniProt: A9BHH8
Position
917459..918559
AA seq 366 aa
MIEYETKVKIDELKENFEDLKDVFNIDKVEEEVKKLDKEMMEPNFWNDQNRAKKISKMAQ
NLKDEIDEFKKLENDFEELEIAVELSEDDPSMTAQVEAILKVIEKKIGSFRLRMLLSEEY
DDANAFLSLHPGAGGTESQDWASMLLRMYTRWADKNNYDIETIDFQEGDEAGIKSATIKI
SGPYAYGKLKYESGVHRLVRISPFDANGRRHTSFASISVMPEFDENVEIEINPDDLKIDT
YRSGGAGGQHVNKTDSAVRITHLPTGIVVAVQNERSQHQNKATALKILKAKLYELEHQKK
LEEKLRLRGEVKDISWGNQIRSYVLYPYTLVKDLRTEYETSNAQAVLDGEIDEFIEEELL
FFAKYK
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgatagaatacgaaacgaaagtaaaaatagacgaattaaaagaaaattttgaagattta
aaagacgtttttaatatagataaagtagaagaagaagtcaaaaaactcgacaaagaaatg
atggaaccaaacttttggaacgatcaaaatagagctaaaaagatctccaaaatggcacaa
aatttaaaagatgaaatagatgaatttaaaaaattggagaacgactttgaggaattagaa
atagctgttgaattatcagaggatgatccatcaatgaccgcccaagttgaagcaatttta
aaagttattgaaaaaaagatcggttcttttcgattaagaatgcttttatcagaagaatac
gatgatgcaaatgcatttctgagtctacatccgggtgcgggaggaacagaatcacaggat
tgggcatctatgctattgagaatgtacactcgttgggcagataaaaataattatgacatt
gaaacgatagactttcaagaaggagacgaagcgggaataaaaagtgcaaccataaaaatt
tcaggcccctatgcttacggtaaattaaaatatgaaagcggtgtacatcgactagtaaga
atttctccatttgacgccaatggaagaaggcacacttctttcgcctcaatatctgtgatg
cctgaatttgatgaaaatgttgagatagaaataaatccagacgatctgaaaatagacacg
tacagatcaggtggagcaggtggacagcatgtcaataaaaccgattctgcggttaggatt
actcatttaccaacaggtatagttgtagctgtacaaaacgagcgttcacaacatcaaaac
aaagccactgctttaaaaatattaaaggctaaattatatgagttagaacatcaaaaaaag
ttagaagaaaagttaagattacgtggtgaggtaaaagatatttcatggggaaatcagatt
agatcatatgttttgtatccatataccttagttaaagatctaagaacagagtatgaaacc
tctaatgctcaagcagtcttggatggagaaatagacgaattcatagaagaagaactgtta
ttctttgcgaaatataagtaa

DBGET integrated database retrieval system