KEGG   Petrotoga mobilis: Pmob_0991
Entry
Pmob_0991         CDS       T00621                                 

Name
(GenBank) calcium-translocating P-type ATPase, PMCA-type
  KO
K01537  P-type Ca2+ transporter type 2C [EC:7.2.2.10]
Organism
pmo  Petrotoga mobilis
Brite
KEGG Orthology (KO) [BR:pmo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pmob_0991
Enzymes [BR:pmo01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     Pmob_0991
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Cation_ATPase_N Hydrolase_3 HAD
Other DBs
NCBI-ProteinID: ABX31713
UniProt: A9BJX0
Position
1052997..1055660
AA seq 887 aa
MWFTKSKDEVIKDLQVNTIQGLSTQEAKERLSRYGENKLATQKNRSLLQLFFAQLNDAMI
YVLLGAALISAILGELSDAIIIAVVILINAVVGLIQEYRAEQALEALKKLSTPKSIVKRD
GKILEIPSEEVVPGDIVIIDAGRYIPCDLRLIETVNLQIDESALTGESVPVDKNADLILE
TLDTPLGDQKNMAFMSTFATYGRGVGVAVATGMKTEIGKIAKMLEETDTEQTPLQKKLTE
LSKILGFAALGISIAMFLVGIIQGRPLFEMFFTAISLAVAAIPEGLPAIVTIVLAMGVQR
MVKKHAIIRKLPAVETLGSVNIICSDKTGTLTQNKMTVVKFYADNAFGDVDSLNINNPAH
KLLLESLVLCNDATYSQESKTGDPTETALLEMGAKFNIFKTAFEEQHPRVNEVPFDSDRK
LMSTVNKYDNEYLVFTKGAPDNLLKICNNAFVNGEIVPLTQEIIDNIMDKVNSMSQDALR
VLGAAFKKIDTPHGDIDKLETDLTFIGLIGMIDPPRLEVKDSIFLCKQAGIKTIMITGDH
KNTAFAIAKELGITDDPSQVISGVELDKLTEEELISKIDNLRVFARVSPEHKVKIVRALK
AKDNIVAMTGDGVNDAPSLKAADIGIAMGITGTDVAKGASDMVLTDDNFSTIVSAVEEGR
NIYNNIKKSIVFLLSCNIGEIITLFFAILFGWATPLKPIHILWVNLITDTFPALSLGVEP
GDKDVMKEKPRNPNHSLFAGGTGVSLILNGALIGLVTLTAFVIGARVYTGTTNLFPIFPA
NISDDALTHAQTMAFVVLSVSQLIHSLNMRHPTKSIFQVGWFTNKYLIASILFGIFLQEI
VITVPFLRNVFGVFDLRLYDWSIVVLLSIVPLVVNEIVKIFIRHKVS
NT seq 2664 nt   +upstreamnt  +downstreamnt
gtgtggtttacaaaaagcaaagacgaagttatcaaagatcttcaggttaatactattcaa
ggactttcaacccaagaagcaaaggaacgtttgagcagatatggggaaaacaaacttgct
acccaaaaaaacaggagcttgctacaattattttttgctcaactcaatgatgcaatgatc
tatgttttgttgggtgcagctttgatctctgcaatattgggggaactcagtgacgcaata
ataattgctgttgttatcttaataaatgcagtagtcggacttatacaagagtatagagct
gaacaagctttggaggctttaaaaaagctttctacacctaagtctatcgttaaaagagat
ggaaaaattcttgaaattccttcagaagaggtagtccctggagacatagttattattgat
gcaggaagatatattccgtgtgatttaagacttatcgaaactgtcaaccttcaaattgac
gaatctgcccttacaggtgaatcagtacctgttgataaaaatgctgatttaatcttagag
acgcttgatactccccttggagaccaaaagaatatggctttcatgtcaacttttgctact
tatggcagaggtgttggggttgcagtagctactggtatgaaaacagaaataggtaaaatt
gctaagatgctcgaagaaactgacacagaacaaactccacttcaaaagaaacttactgag
cttagtaaaatacttggctttgcagctcttggaatttctattgctatgttccttgtcggt
atcatccaaggaagacctttatttgaaatgttctttacggcaataagtcttgcagtagca
gcaattccggaaggacttcctgcaatagttacaatagtacttgctatgggtgttcaaagg
atggttaaaaagcacgccataattagaaagcttccagcggttgaaactttaggttctgta
aacataatatgctctgataaaacgggtaccttaactcaaaataagatgactgtggtaaaa
ttctacgcagacaatgcttttggcgatgttgactcacttaatattaataatccagctcat
aaactccttttggagagtttggtactatgtaacgatgctacttattcgcaggaatcaaag
actggtgatccaactgaaacagccttacttgagatgggagctaaattcaatatatttaaa
actgcttttgaagagcaacacccaagagtaaatgaagtaccctttgattcggatagaaag
cttatgtccactgtaaataaatatgataatgagtatttagtgtttactaagggagccccg
gataatcttcttaagatatgtaacaatgcatttgtcaatggtgagattgttccactaaca
caggaaattatagataacataatggataaagtaaattcaatgtctcaggatgcccttaga
gttttaggagcagccttcaaaaaaatagatactcctcacggagatattgataaattagaa
accgacttaacctttataggcttaataggtatgattgacccgccaagactcgaggtgaag
gattctatatttttatgcaaacaggctggtataaagactattatgataacaggtgatcat
aaaaatactgcctttgctatagcaaaagaacttggtataactgatgatccttcacaggta
atatccggagttgaactagataagcttaccgaggaggagttaattagtaagatcgataac
ttgagagtatttgcaagagtctcacctgaacataaggtaaaaatagttcgagctcttaaa
gccaaagataacatcgttgccatgactggagatggggtaaacgatgctccctcattaaag
gctgcagatattgggattgcaatggggattacaggtacagatgttgcaaagggtgcttct
gacatggtcttaacagatgataactttagcactatagtttctgctgttgaggaaggaaga
aatatatacaacaatattaaaaagtccatcgtcttcctgctgtcatgtaatattggtgaa
ataattacgttgttctttgccatattatttggttgggctacaccgttaaagcctatacac
atactatgggttaacttaataactgacactttcccggcgctatctcttggagtagagcca
ggggacaaagatgttatgaaagaaaaaccacgtaatccaaatcacagtttgtttgcaggc
ggtacaggagtaagtttaatactaaacggggcattaattggtttagtaacattaaccgcc
tttgtgattggggcaagagtttatacaggtactactaatttattcccaatatttcctgcg
aatatttcagatgatgcgttaactcacgcacaaaccatggcgtttgtagtgttaagtgta
tctcaactaatacactctttgaatatgagacatccaaccaaatccatattccaagttggt
tggtttacaaacaagtaccttatcgcctctatcctatttgggatattcctccaggaaatt
gtcataacagttccatttctcagaaatgtgtttggggtcttcgatttaagactttatgac
tggtcaattgttgtattactatctatagttcctttggtagttaatgaaatagtaaagata
tttattaggcataaggtatcttaa

DBGET integrated database retrieval system