KEGG   Petrotoga mobilis: Pmob_1152Help
Entry
Pmob_1152         CDS       T00621                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00260  Glycine, serine and threonine metabolism
pmo00750  Vitamin B6 metabolism
pmo01100  Metabolic pathways
pmo01110  Biosynthesis of secondary metabolites
pmo01120  Microbial metabolism in diverse environments
pmo01230  Biosynthesis of amino acids
Module
pmo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pmob_1152
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pmob_1152
Enzymes [BR:pmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pmob_1152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABX31870
UniProt: A9BHJ8
Position
complement(1233838..1234902)
Genome map
AA seq 354 aa AA seqDB search
MRNFSFWPGIINAYKEYMPVDEKTEIITLQEGNTPLIFAEKMSNMWDIELYLKYDGANPT
GSFKDRGMCLAVTKALQNGDKAIICASTGNTSASAAAYGSRAGLKTAVIIPEGKIALGKL
SQALMHGAIVIPIKGNFDVALEITRKIADNYPITLVNSLNPYRIEGQKSAAFEVCDQLGG
KSPDILAIPVGNAGNITAYWKGFKEYFKDHKTDKLPKMIGFEAEGSAAIVKNQVIKNPET
VATAIRIGNPVNWEKAVEAAKESGGFINFVTDEEILDTYKELASLEGVFAEPASAASVAG
VKKMIKLDKIKKGSKIVAVLTGHGLKDPDTAISVIPKVNPVEPEMETILKLIGL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaattttagtttttggccgggtataataaatgcttataaagaatacatgcccgtc
gatgagaaaacagagataattacgttgcaagaagggaacactcctttgatattcgcagaa
aaaatgagtaatatgtgggatattgagctttatctgaaatatgatggtgctaatcccacg
ggatcttttaaagacaggggaatgtgtttagccgtaaccaaagccctgcagaacggtgat
aaagcaataatctgtgcttctaccggtaacacttctgcctctgctgcggcttatggaagt
agagcaggattgaaaacagcggtcataatccctgaagggaagatcgccttggggaaatta
tctcaggccttaatgcatggggctatagttataccgataaaaggtaattttgacgttgcc
ttagagattacaagaaagatcgctgacaactatcctataactctggttaactcacttaat
ccatacaggatagaaggtcaaaaaagtgctgcttttgaggtatgtgatcaattaggtggt
aaatctcctgacatattggcaattccagtggggaatgcgggaaacatcacagcttactgg
aaagggttcaaagaatacttcaaagatcacaaaacggataagttacctaagatgattggt
tttgaagcggaaggatcagctgctatcgtaaaaaatcaggttataaaaaacccagaaacc
gtagcaacagctataagaataggtaatccggtcaattgggaaaaggccgtagaagctgca
aaagaatctggaggatttataaattttgttaccgacgaggaaatcttggacacgtataaa
gaattggcatccctcgaaggtgtgtttgcagaacctgcttctgcagcttcggtagcgggc
gttaaaaaaatgatcaaattggataagataaaaaaaggaagtaaaattgttgcggtactc
acgggacatggattaaaggatcccgataccgcgataagtgtgataccaaaggtcaatcca
gtagaaccagaaatggaaactatattgaaattgatagggctgtaa

DBGET integrated database retrieval system