KEGG   Petrotoga mobilis: Pmob_1169
Entry
Pmob_1169         CDS       T00621                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00472  D-Arginine and D-ornithine metabolism
pmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Pmob_1169
Enzymes [BR:pmo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Pmob_1169
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A Ntox34
Other DBs
NCBI-ProteinID: ABX31887
UniProt: A9BHL5
Position
1253660..1254046
AA seq 128 aa
MKERADDFQERSKKLQNLTDEELDNYFWNLVGKVVDPLVNLAETHTSPSIERSVLLRMGF
NSLQAKALVDKIVQENLLSKGAGNVVYKIAKQKNIGIMEAGEALLNGRFWDDVENIFRGG
DTSETSTK
NT seq 387 nt   +upstreamnt  +downstreamnt
gtgaaagaaagagccgatgactttcaggaaaggtcaaagaaacttcaaaacttgactgat
gaggaattagacaattatttttggaatttagttggaaaggtagtagatcccttagtaaat
ttggcagaaacacatacctctccttctatagaaagatctgtcttgctgagaatggggttt
aattcccttcaggcaaaggcgttggttgataagattgtacaagaaaatttattatcaaaa
ggagcagggaatgtggtctacaaaatcgcaaaacaaaaaaatataggaataatggaagcg
ggagaggcactattaaacggtcgtttttgggatgatgttgagaatatctttagaggtggt
gatacaagtgaaacttcaaccaaatga

DBGET integrated database retrieval system