KEGG   Petrotoga mobilis: Pmob_1207Help
Entry
Pmob_1207         CDS       T00621                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00260  Glycine, serine and threonine metabolism
pmo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmo01100  Metabolic pathways
pmo01110  Biosynthesis of secondary metabolites
pmo01130  Biosynthesis of antibiotics
pmo01230  Biosynthesis of amino acids
Module
pmo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pmob_1207
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pmob_1207
Enzymes [BR:pmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pmob_1207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth Ribul_P_3_epim HMGL-like BtpA
Motif
Other DBs
NCBI-ProteinID: ABX31924
UniProt: A9BHQ2
Position
complement(1290330..1291106)
Genome map
AA seq 258 aa AA seqDB search
MSKISEVFKNSKALITYVTAGDPNLEVTKEIILELNKDGVDIIEVGIPFSDPLADGPIIQ
KASQKALKNGVTLKKIFETLNEIKEEVTCPLVLMGYYNSILNYGIDNFITEAVNTGISGV
IIPDLPFDEEEEFYAKIKENGIDPILLVAPNTSEERLKEISKVCSGFLYCVSIMGVTGDS
QAPMEHLKEYSQRVRKYVNIPLAIGFGIDSPTKAKNIIEYFDGIIVGSALIKIIDENSDD
KGKLLKEIKRFTKSLKVW
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaataagtgaagttttcaaaaatagcaaggctttaatcacctatgtaacagcc
ggagatccgaacttagaggttacaaaagaaattatattagaattgaacaaagatggtgtt
gatattatagaggtaggaatacctttttccgatcctttagcagatggaccaataattcaa
aaagcaagccaaaaagctttaaaaaatggggttacccttaaaaaaatttttgaaaccttg
aatgaaatcaaagaagaggttacttgcccactcgttttaatgggttattacaactcaatt
ctcaattatggtatcgacaattttataacagaagccgtgaatacaggcatctctggagta
ataattcctgatttgccttttgacgaagaagaggaattttacgcaaaaataaaagaaaac
ggtatcgatcctattttactagttgctccaaatacctctgaagagcgactaaaagaaatc
tctaaggtatgttctggatttttgtattgtgtatctattatgggagtaacaggggatagt
caagcacctatggagcatttgaaagagtattcacaaagagtgagaaagtatgttaatata
cctttagctatcggttttggaatagatagcccgacaaaggctaaaaatattattgaatac
ttcgatggaataattgtgggaagtgccctaataaaaataatcgatgaaaacagtgatgac
aaaggtaagttgcttaaagaaataaaaagatttactaaaagtttgaaagtatggtga

DBGET integrated database retrieval system